SOX13 (NM_005686) Human Tagged ORF Clone

CAT#: RC210697

Reviews ()
Write a review

SOX13 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 13 (SOX13)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SOX13
Synonyms ICA12; Sox-13
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210697 representing NM_005686
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCATGAGGAGCCCCATCTCTGCCCAGCTGGCCCTGGATGGCGTTGGCACCATGGTGAACTGCACCA
TCAAGTCAGAGGAGAAGAAAGAGCCTTGCCACGAGGCCCCCCAGGGCTCAGCCACTGCCGCTGAACCTCA
GCCTGGAGACCCAGCCCGGGCCTCCCAGGATAGTGCTGACCCCCAAGCTCCAGCCCAGGGGAATTTCAGG
GGCTCCTGGGACTGTAGCTCTCCAGAGGGTAATGGGTCCCCAGAACCCAAGAGACCAGGAGTGTCGGAGG
CTGCCTCTGGAAGCCAGGAGAAGCTGGACTTCAACCGAAATTTGAAAGAAGTGGTGCCAGCCATAGAGAA
GCTGTTGTCCAGTGACTGGAAGGAGAGGTTTCTAGGAAGGAACTCTATGGAAGCCAAAGATGTCAAAGGG
ACCCAAGAGAGCCTAGCAGAGAAGGAGCTCCAGCTTCTGGTCATGATTCACCAGCTGTCCACCCTGCGGG
ACCAGCTCCTGACAGCCCACTCGGAGCAGAAGAACATGGCTGCCATGCTGTTTGAGAAGCAGCAGCAGCA
GATGGAGCTTGCCCGGCAGCAGCAGGAGCAGATTGCAAAGCAGCAGCAGCAGCTGATTCAGCAGCAGCAT
AAGATCAACCTCCTTCAGCAGCAGATCCAGCAGGTTAACATGCCTTATGTCATGATCCCAGCCTTCCCCC
CAAGCCACCAACCTCTGCCTGTCACCCCTGACTCCCAGCTGGCCTTACCCATTCAGCCCATTCCCTGCAA
ACCAGTGGAGTATCCGCTGCAGCTGCTGCACAGCCCCCCTGCCCCAGTGGTGAAGAGGCCTGGGGCCATG
GCCACCCACCACCCCCTGCAGGAGCCCTCCCAGCCCCTGAACCTCACAGCCAAGCCCAAGGCCCCCGAGC
TGCCCAACACCTCCAGCTCCCCAAGCCTGAAGATGAGCAGCTGTGTGCCCCGCCCCCCCAGCCATGGAGG
CCCCACGCGGGACCTGCAGTCCAGCCCCCCGAGCCTGCCTCTGGGCTTCCTTGGTGAAGGGGACGCTGTC
ACCAAAGCCATCCAGGATGCTCGGCAGCTGCTGCACAGCCACAGTGGGGCCTTGGATGGCTCCCCCAACA
CCCCCTTCCGTAAGGACCTCATCAGCCTGGACTCATCCCCAGCCAAGGAGCGGCTGGAGGACGGCTGTGT
GCACCCACTGGAGGAAGCCATGCTGAGCTGCGACATGGATGGCTCCCGCCACTTCCCCGAGTCCCGAAAC
AGCAGCCACATCAAGAGGCCCATGAACGCCTTCATGGTGTGGGCCAAGGATGAGCGGAGGAAGATCCTGC
AAGCCTTCCCAGACATGCACAACTCCAGCATCAGCAAGATCCTTGGATCTCGCTGGAAGTCCATGACCAA
CCAGGAGAAGCAGCCCTACTATGAGGAACAGGCGCGGCTGAGCCGGCAGCACCTGGAGAAGTATCCTGAC
TACAAGTACAAGCCGCGGCCCAAGCGCACCTGCATCGTGGAGGGCAAGCGGCTGCGCGTGGGAGAGTACA
AGGCCCTGATGAGGACCCGGCGTCAGGATGCCCGCCAGAGCTACGTGATCCCCCCGCAGGCTGGCCAGGT
GCAGATGAGCTCCTCAGATGTCCTGTACCCTCGGGCAGCAGGCATGCCGCTGGCACAGCCACTGGTGGAG
CACTATGTCCCTCGTAGCCTGGACCCCAACATGCCTGTGATCGTCAACACCTGCAGCCTCAGAGAGGAGG
GTGAGGGCACAGATGACAGGCACTCGGTGGCTGATGGCGAGATGTACCGGTACAGCGAGGACGAGGACTC
GGAGGGCGAAGAGAAGAGCGATGGGGAGTTGGTGGTGCTCACAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210697 representing NM_005686
Red=Cloning site Green=Tags(s)

MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFR
GSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKG
TQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQH
KINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAM
ATHHPLQEPSQPLNLTAKPKAPELPNTSSSPSLKMSSCVPRPPSHGGPTRDLQSSPPSLPLGFLGEGDAV
TKAIQDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDMDGSRHFPESRN
SSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPD
YKYKPRPKRTCIVEGKRLRVGEYKALMRTRRQDARQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVE
HYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLTD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005686
ORF Size 1866 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005686.3
RefSeq Size 4088 bp
RefSeq ORF 1869 bp
Locus ID 9580
UniProt ID Q9UN79
Cytogenetics 1q32.1
Protein Families Transcription Factors
MW 69 kDa
Gene Summary This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. [provided by RefSeq, Jul 2008]
Other products for "SOX13"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.