PYGL (NM_002863) Human Tagged ORF Clone

CAT#: RC210683

PYGL (Myc-DDK-tagged)-Human phosphorylase, glycogen, liver (PYGL), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_002863" in other vectors (6)

Reconstitution Protocol

USD 776.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


PYGL Rabbit polyclonal Antibody
    • 100 ul

USD 365.00

Other products for "PYGL"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PYGL
Synonyms GSD6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210683 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAAGCCCCTGACGGACCAGGAGAAGCGGCGGCAGATCAGCATCCGCGGCATCGTGGGCGTGGAGA
ACGTGGCAGAGCTGAAGAAGAGTTTCAACCGGCACCTGCACTTCACGCTGGTCAAGGACCGCAACGTGGC
CACCACCCGCGACTACTACTTCGCGCTGGCGCACACGGTGCGCGACCACCTGGTGGGGCGCTGGATCCGC
ACGCAGCAGCACTACTACGACAAGTGCCCCAAGAGGGTATATTACCTCTCTCTGGAATTTTACATGGGCC
GAACATTACAGAACACCATGATCAACCTCGGTCTGCAAAATGCCTGTGATGAGGCCATTTACCAGCTTGG
ATTGGATATAGAAGAGTTAGAAGAAATTGAAGAAGATGCTGGACTTGGCAATGGTGGTCTTGGGAGACTT
GCTGCCTGCTTCTTGGATTCCATGGCAACCCTGGGACTTGCAGCCTATGGATACGGCATTCGGTATGAAT
ATGGGATTTTCAATCAGAAGATCCGAGATGGATGGCAGGTAGAAGAAGCAGATGATTGGCTCAGATATGG
AAACCCTTGGGAGAAGTCCCGCCCAGAATTCATGCTGCCTGTGCACTTCTATGGAAAAGTAGAACACACC
AACACCGGGACCAAGTGGATTGACACTCAAGTGGTCCTGGCTCTGCCATATGACACCCCCGTGCCCGGCT
ACATGAATAACACTGTCAACACCATGCGCCTCTGGTCTGCTCGGGCACCAAATGACTTTAACCTCAGAGA
CTTTAATGTTGGAGACTACATTCAGGCTGTGCTGGACCGAAACCTGGCCGAGAACATCTCCCGGGTCCTC
TATCCCAATGACAATTTTTTTGAAGGGAAGGAGCTAAGATTGAAGCAGGAATACTTTGTGGTGGCTGCAA
CCTTGCAAGATATCATCCGCCGTTTCAAAGCCTCCAAGTTTGGCTCCACCCGTGGTGCAGGAACTGTGTT
TGATGCCTTCCCGGATCAGGTGGCCATCCAGCTGAATGACACTCACCCTGCACTCGCGATCCCTGAGCTG
ATGAGGATTTTTGTGGATATTGAAAAACTGCCCTGGTCCAAGGCATGGGAGCTCACCCAGAAGACCTTCG
CCTACACCAACCACACAGTGCTCCCGGAAGCCCTGGAGCGCTGGCCCGTGGACCTGGTGGAGAAGCTGCT
CCCTCGACATTTGGAAATCATTTATGAGATAAATCAGAAGCATTTAGATAGAATTGTGGCCTTGTTTCCT
AAAGATGTGGACCGTCTGAGAAGGATGTCTCTGATAGAAGAGGAAGGAAGCAAAAGGATCAACATGGCCC
ATCTCTGCATTGTCGGTTCCCATGCTGTGAATGGCGTGGCTAAAATCCACTCAGACATCGTGAAGACTAA
AGTATTCAAGGACTTCAGTGAGCTAGAACCTGACAAGTTTCAGAATAAAACCAATGGGATCACTCCAAGG
CGCTGGCTCCTACTCTGCAACCCAGGACTTGCAGAGCTCATAGCAGAGAAAATTGGAGAAGACTATGTGA
AAGACCTGAGCCAGCTGACGAAGCTCCACAGCTTCCTGGGTGATGATGTCTTCCTCCGGGAACTCGCCAA
GGTGAAGCAGGAGAATAAGCTGAAGTTTTCTCAGTTCCTGGAGACGGAGTACAAAGTGAAGATCAACCCA
TCCTCCATGTTTGATGTCCAGGTGAAGAGGATACATGAGTACAAGCGACAGCTCTTGAACTGTCTGCATG
TGATCACGATGTACAACCGCATTAAGAAAGACCCTAAGAAGTTATTCGTGCCAAGGACAGTTATCATTGG
TGGTAAAGCTGCCCCAGGATATCACATGGCCAAAATGATCATAAAGCTGATCACTTCAGTGGCAGATGTG
GTGAACAATGACCCTATGGTTGGAAGCAAGTTGAAAGTCATCTTCTTGGAGAACTACAGAGTATCTCTTG
CTGAAAAAGTCATTCCAGCCACAGATCTGTCAGAGCAGATTTCCACTGCAGGCACCGAAGCCTCGGGGAC
AGGCAATATGAAGTTCATGCTAAATGGGGCCCTAACTATCGGGACCATGGATGGGGCCAATGTGGAAATG
GCAGAAGAAGCTGGGGAAGAGAACCTGTTCATCTTTGGCATGAGGATAGATGATGTGGCTGCTTTGGACA
AGAAAGGGTACGAGGCAAAAGAATACTATGAGGCACTTCCAGAGCTGAAGCTGGTCATTGATCAAATTGA
CAATGGCTTTTTTTCTCCCAAGCAGCCTGACCTCTTCAAAGATATCATCAACATGCTATTTTATCATGAC
AGGTTTAAAGTCTTTGCAGACTACGAAGCCTATGTCAAGTGTCAAGATAAAGTGAGTCAGCTGTACATGA
ATCCAAAGGCCTGGAACACAATGGTACTCAAAAACATAGCTGCCTCGGGGAAATTCTCCAGTGACCGAAC
AATTAAAGAATATGCCCAAAACATCTGGAACGTGGAACCTTCAGATCTAAAGATTTCTCTATCCAATGAA
TCTAACAAAGTCAATGGAAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210683 protein sequence
Red=Cloning site Green=Tags(s)

MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIR
TQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRL
AACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHT
NTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVL
YPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPEL
MRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPR
RWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINP
SSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADV
VNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEM
AEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHD
RFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE
SNKVNGN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002863
ORF Size 2541 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002863.5
RefSeq Size 2859 bp
RefSeq ORF 2544 bp
Locus ID 5836
UniProt ID P06737
Cytogenetics 14q22.1
Domains phosphorylase
Protein Families Druggable Genome
Protein Pathways Insulin signaling pathway, Starch and sucrose metabolism
MW 97.1 kDa
Gene Summary This gene encodes a homodimeric protein that catalyses the cleavage of alpha-1,4-glucosidic bonds to release glucose-1-phosphate from liver glycogen stores. This protein switches from inactive phosphorylase B to active phosphorylase A by phosphorylation of serine residue 15. Activity of this enzyme is further regulated by multiple allosteric effectors and hormonal controls. Humans have three glycogen phosphorylase genes that encode distinct isozymes that are primarily expressed in liver, brain and muscle, respectively. The liver isozyme serves the glycemic demands of the body in general while the brain and muscle isozymes supply just those tissues. In glycogen storage disease type VI, also known as Hers disease, mutations in liver glycogen phosphorylase inhibit the conversion of glycogen to glucose and results in moderate hypoglycemia, mild ketosis, growth retardation and hepatomegaly. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Feb 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.