OTUB1 (NM_017670) Human Tagged ORF Clone

CAT#: RC210648

Reviews ()
Write a review

OTUB1 (Myc-DDK-tagged)-Human OTU domain, ubiquitin aldehyde binding 1 (OTUB1), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol OTUB1
Synonyms HSPC263; OTB1; OTU1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210648 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGAGGAACCTCAGCAGCAGAAGCAGGAGCCGCTGGGCAGCGACTCCGAAGGTGTTAACTGTC
TGGCCTATGATGAAGCCATCATGGCTCAGCAGGACCGAATTCAGCAAGAGATTGCTGTGCAGAACCCTCT
GGTGTCAGAGCGGCTGGAGCTCTCGGTCCTATACAAGGAGTATGCTGAAGATGACAACATCTATCAACAG
AAGATCAAGGACCTCCACAAAAAGTACTCGTACATCCGCAAGACCAGGCCTGACGGCAACTGTTTCTATC
GGGCTTTCGGATTCTCCCACTTGGAGGCACTGCTGGATGACAGCAAGGAGTTGCAGCGGTTCAAGGCTGT
GTCTGCCAAGAGCAAGGAAGACCTGGTGTCCCAGGGCTTCACTGAATTCACAATTGAGGATTTCCACAAC
ACGTTCATGGACCTGATTGAGCAGGTGGAGAAGCAGACCTCTGTCGCCGACCTGCTGGCCTCCTTCAATG
ACCAGAGCACCTCCGACTACCTTGTGGTCTACCTGCGGCTGCTCACCTCGGGCTACCTGCAGCGCGAGAG
CAAGTTCTTCGAGCACTTCATCGAGGGTGGACGGACTGTCAAGGAGTTCTGCCAGCAGGAGGTGGAGCCC
ATGTGCAAGGAGAGCGACCACATCCACATCATTGCGCTGGCCCAGGCCCTCAGCGTGTCCATCCAGGTGG
AGTACATGGACCGCGGCGAGGGCGGCACCACCAATCCGCACATCTTCCCTGAGGGCTCCGAGCCCAAGGT
CTACCTTCTCTACCGGCCTGGACACTACGATATCCTCTACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210648 protein sequence
Red=Cloning site Green=Tags(s)

MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQ
KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHN
TFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEP
MCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017670
ORF Size 813 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 2310 bp
RefSeq ORF 816 bp
Locus ID 55611
UniProt ID Q96FW1
Cytogenetics 11q13.1
Protein Families Protease
MW 31.3 kDa
Gene Summary The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Other products for "OTUB1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.