PLSCR3 (NM_020360) Human Tagged ORF Clone

CAT#: RC210587

Reviews ()
Write a review

PLSCR3 (Myc-DDK-tagged)-Human phospholipid scramblase 3 (PLSCR3), transcript variant 1



  "NM_020360" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PLSCR3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210587 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGCTACTTGCCCCCCAAAGGCTACGCCCCTTCGCCCCCACCTCCCTACCCTGTCACCCCTGGGT
ACCCGGAGCCGGCGCTACATCCTGGGCCCGGGCAGGCGCCAGTGCCCGCCCAGGTACCTGCCCCAGCTCC
CGGCTTCGCCCTCTTCCCCTCGCCTGGCCCCGTGGCCTTGGGGTCTGCTGCCCCCTTCTTGCCACTGCCA
GGGGTGCCTTCTGGCCTCGAATTCCTGGTGCAGATTGATCAGATTTTGATTCACCAGAAGGCTGAGCGAG
TGGAAACGTTCCTAGGCTGGGAGACCTGTAATCGGTATGAACTGCGCTCTGGGGCCGGGCAGCCCCTGGG
TCAGGCGGCCGAGGAGAGCAACTGCTGCGCCCGTCTGTGCTGTGGCGCCCGCCGGCCGCTGCGTGTCCGC
CTGGCCGACCCCGGGGACCGTGAGGTGCTGCGTTTGCTCCGCCCGCTGCACTGTGGCTGCAGCTGCTGCC
CCTGTGGCCTCCAGGAGATGGAAGTACAGGCTCCACCAGGCACCACCATTGGCCACGTGCTACAGACCTG
GCATCCCTTCCTCCCCAAGTTCTCCATCCAGGATGCCGATCGCCAGACAGTCTTGCGAGTGGTGGGGCCC
TGCTGGACCTGTGGCTGTGGCACAGACACCAACTTTGAGGTGAAGACTCGGGATGAATCCCGCAGTGTGG
GCCGCATCAGCAAGCAGTGGGGGGGCCTGGTCCGAGAAGCCCTCACAGATGCAGATGACTTTGGCCTACA
GTTCCCGCTGGACCTGGATGTGAGGGTGAAGGCTGTGCTGCTGGGAGCCACATTCCTCATTGACTACATG
TTCTTTGAGAAGCGAGGAGGCGCTGGGCCCTCTGCCGTCACCAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210587 protein sequence
Red=Cloning site Green=Tags(s)

MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLP
GVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVR
LADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGP
CWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYM
FFEKRGGAGPSAVTS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020360
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020360.4
RefSeq Size 2089 bp
RefSeq ORF 888 bp
Locus ID 57048
UniProt ID Q9NRY6
Cytogenetics 17p13.1
Domains Scramblase
MW 31.6 kDa
Gene Summary May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "PLSCR3"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


Rabbit Polyclonal Anti-PLSCR3 Antibody - middle region
    • 100 ul

USD 475.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.