FBXO2 (NM_012168) Human Tagged ORF Clone

CAT#: RC210500

FBXO2 (Myc-DDK-tagged)-Human F-box protein 2 (FBXO2)



  "NM_012168" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "FBXO2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FBXO2
Synonyms FBG1; Fbs1; FBX2; NFB42; OCP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210500 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGGAGACGGTGACCCAGAGAGCGTGGGCCAGCCCGAGGAGGCAAGCCCGGAGGAGCAGCCAGAGG
AGGCGAGTGCTGAGGAGGAGCGGCCGGAGGACCAGCAGGAGGAGGAGGCGGCGGCCGCCGCCGCGTACCT
GGACGAGCTGCCCGAGCCGCTGCTGCTGCGCGTGCTGGCCGCACTGCCGGCCGCCGAGCTGGTGCAGGCC
TGCCGCCTGGTGTGCCTGCGCTGGAAGGAGCTGGTGGACGGCGCCCCGCTGTGGCTGCTCAAGTGCCAGC
AGGAGGGGCTGGTGCCCGAGGGCGGCGTGGAGGAGGAGCGCGACCACTGGCAGCAGTTCTACTTCCTGAG
CAAGCGGCGCCGCAACCTTCTGCGTAACCCGTGTGGGGAAGAGGACTTGGAAGGCTGGTGTGACGTGGAG
CATGGTGGGGACGGCTGGAGGGTGGAGGAGCTGCCTGGAGACAGTGGGGTGGAGTTCACCCACGATGAGA
GCGTCAAGAAGTACTTCGCCTCCTCCTTTGAGTGGTGTCGCAAAGCACAGGTCATTGACCTGCAGGCTGA
GGGCTACTGGGAGGAGCTGCTGGACACGACTCAGCCGGCCATCGTGGTGAAGGACTGGTACTCGGGCCGC
AGCGACGCTGGTTGCCTCTACGAGCTCACCGTTAAGCTACTGTCCGAGCACGAGAACGTGCTGGCTGAGT
TCAGCAGCGGGCAGGTGGCAGTGCCCCAAGACAGTGACGGCGGGGGCTGGATGGAGATCTCCCACACCTT
CACCGACTACGGGCCGGGCGTCCGCTTCGTCCGCTTCGAGCACGGGGGGCAGGACTCCGTCTACTGGAAG
GGCTGGTTCGGGGCCCGGGTGACCAACAGCAGCGTGTGGGTAGAACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210500 protein sequence
Red=Cloning site Green=Tags(s)

MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQA
CRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVE
HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGR
SDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWK
GWFGARVTNSSVWVEP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012168
ORF Size 888 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012168.6
RefSeq Size 1724 bp
RefSeq ORF 891 bp
Locus ID 26232
UniProt ID Q9UK22
Cytogenetics 1p36.22
Domains F-box, FBA
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
MW 33.3 kDa
Gene Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is highly similar to the rat NFB42 (neural F Box 42 kDa) protein which is enriched in the nervous system and may play a role in maintaining neurons in a postmitotic state. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.