COP1(RFWD2) (NM_022457) Human Tagged ORF Clone

CAT#: RC210492

RFWD2 (Myc-DDK-tagged)-Human ring finger and WD repeat domain 2 (RFWD2), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name COP1(RFWD2) (NM_022457) Human Tagged ORF Clone
Symbol RFWD2
Synonyms COP1; RNF200
Vector pCMV6-Entry
Sequence Data
>RC210492 representing NM_022457
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGTAGCCGCCAGGCCGGGTCGGGCTCCGCTGGGACAAGCCCCGGGTCCTCGGCGGCCTCCTCGG
TGACTTCCGCCTCCTCGTCTTTATCCTCTTCCCCGTCGCCGCCTTCCGTGGCGGTTTCGGCGGCAGCGCT
GGTGTCCGGCGGGGTGGCCCAGGCCGCCGGCTCGGGCGGCCTCGGGGGCCCGGTGCGGCCTGTGTTGGTG
GCGCCCGCCGTATCGGGTAGCGGCGGCGGGGCGGTGTCCACGGGCCTGTCCCGGCACAGCTGCGCGGCCA
GGCCCAGCGCCGGCGTAGGAGGCAGCAGCTCCAGCCTAGGCAGCGGCAGCAGGAAGCGACCTCTCCTCGC
CCCCCTCTGCAACGGGCTCATCAACTCCTACGAGGACAAAAGCAACGACTTCGTATGCCCCATCTGCTTT
GATATGATTGAAGAAGCATACATGACAAAATGTGGCCACAGCTTTTGCTACAAGTGTATTCATCAGAGTT
TGGAGGACAATAATAGATGTCCCAAGTGTAACTATGTTGTGGACAATATTGACCATCTGTATCCTAATTT
CTTGGTGAATGAACTCATTCTTAAACAGAAGCAAAGATTTGAGGAAAAGAGGTTCAAATTGGACCACTCA
GTGAGTAGCACCAATGGCCACAGGTGGCAGATATTTCAAGATTGGTTGGGAACTGACCAAGATAACCTTG
ATTTGGCCAATGTCAATCTTATGTTGGAGTTACTAGTGCAGAAGAAGAAACAACTGGAAGCAGAATCACA
TGCAGCCCAACTACAGATTCTTATGGAATTCCTCAAGGTTGCAAGAAGAAATAAGAGAGAGCAACTGGAA
CAGATCCAGAAGGAGCTAAGTGTTTTGGAAGAGGATATTAAGAGAGTGGAAGAAATGAGTGGCTTATACT
CTCCTGTCAGTGAGGATAGCACAGTGCCTCAATTTGAAGCTCCTTCTCCATCACACAGTAGTATTATTGA
TTCCACAGAATACAGCCAACCTCCAGGTTTCAGTGGCAGTTCTCAGACAAAGAAACAGCCTTGGTATAAT
AGCACGTTAGCATCAAGACGAAAACGACTTACTGCTCATTTTGAAGACTTGGAGCAGTGTTACTTTTCTA
CAAGGATGTCTCGTATCTCAGATGACAGTCGAACTGCAAGCCAGTTGGATGAATTTCAGGAATGCTTGTC
CAAGTTTACTCGATATAATTCAGTACGACCTTTAGCCACATTGTCATATGCTAGTGATCTCTATAATGGT
TCCAGTATAGTCTCTAGTATTGAATTTGACCGGGATTGTGACTATTTTGCGATTGCTGGAGTTACAAAGA
AGATTAAAGTCTATGAATATGACACTGTCATCCAGGATGCAGTGGATATTCATTACCCTGAGAATGAAAT
GACCTGCAATTCGAAAATCAGCTGTATCAGTTGGAGTAGTTACCATAAGAACCTGTTAGCTAGCAGTGAT
TATGAAGGCACTGTTATTTTATGGGATGGATTCACAGGACAGAGGTCAAAGGTCTATCAGGAGCATGAGA
AGAGGTGTTGGAGTGTTGACTTTAATTTGATGGATCCTAAACTCTTGGCTTCAGGTTCTGATGATGCAAA
AGTGAAGCTGTGGTCTACCAATCTAGACAACTCAGTGGCAAGCATTGAGGCAAAGGCTAATGTGTGCTGT
GTTAAATTCAGCCCCTCTTCCAGATACCATTTGGCTTTCGGCTGTGCAGATCACTGTGTCCACTACTATG
ATCTTCGTAACACTAAACAGCCAATCATGGTATTCAAAGGACACCGTAAAGCAGTCTCTTATGCAAAGTT
TGTGAGTGGTGAGGAAATTGTCTCTGCCTCAACAGACAGTCAGCTAAAACTGTGGAATGTAGGGAAACCA
TACTGCCTACGTTCCTTCAAGGGTCATATCAATGAAAAAAACTTTGTAGGCCTGGCTTCCAATGGAGATT
ATATAGCTTGTGGAAGTGAAAATAACTCTCTCTACCTGTACTATAAAGGACTTTCTAAGACTTTGCTAAC
TTTTAAGTTTGATACAGTCAAAAGTGTTCTCGACAAAGACCGAAAAGAAGATGATACAAATGAATTTGTT
AGTGCTGTGTGCTGGAGGGCACTACCAGATGGGGAGTCCAATGTGCTGATTGCTGCTAACAGTCAGGGTA
CAATTAAGGTGCTAGAATTGGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210492 representing NM_022457
Red=Cloning site Green=Tags(s)

MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLV
APAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICF
DMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHS
VSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLE
QIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYN
STLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNG
SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSD
YEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCC
VKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKP
YCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFV
SAVCWRALPDGESNVLIAANSQGTIKVLELV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_022457
ORF Size 2193 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022457.4, NM_022457.5, NM_022457.6, NP_071902
RefSeq Size 2801
RefSeq ORF 2196
Locus ID 64326
Cytogenetics 1q25.1-q25.2
Domains WD40, RING
Protein Pathways p53 signaling pathway, Ubiquitin mediated proteolysis
MW 80.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)