PVRIG (NM_024070) Human Tagged ORF Clone

CAT#: RC210470

PVRIG (Myc-DDK-tagged)-Human poliovirus receptor related immunoglobulin domain containing (PVRIG)

Change vector?

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name PVRIG (NM_024070) Human Tagged ORF Clone
Symbol PVRIG
Synonyms C7orf15
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC210470 representing NM_024070
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAACAGAGGCACAGGTGCCGGCCCTGCAGCCCCCAGAACCTGGACTGGAGGGGGCCATGGGGCACC
GGACCCTGGTCCTGCCCTGGGTGCTGCTGACCTTGTGTGTCACTGCGGGGACCCCGGAGGTGTGGGTTCA
AGTTCGGATGGAGGCCACCGAGCTCTCGTCCTTCACCATCCGTTGTGGGTTCCTGGGGTCTGGCTCCATC
TCCCTGGTGACTGTGAGCTGGGGGGGCCCCAACGGTGCTGGGGGGACCACGCTGGCTGTGTTGCACCCAG
AACGTGGCATCCGGCAATGGGCCCCTGCTCGCCAGGCCCGCTGGGAAACCCAGAGCAGCATCTCTCTCAT
CCTGGAAGGCTCTGGGGCCAGCAGCCCCTGCGCCAACACCACCTTCTGCTGCAAGTTTGCGTCCTTCCCT
GAGGGCTCCTGGGAGGCCTGTGGGAGCCTCCCGCCCAGCTCAGACCCAGGGCTCTCTGCCCCGCCGACTC
CTGCCCCCATTCTGCGGGCAGACCTGGCCGGGATCTTGGGGGTCTCAGGAGTCCTCCTCTTTGGCTGTGT
CTACCTCCTTCATCTGCTGCGCCGACATAAGCACCGCCCTGCCCCTAGGCTCCAGCCGTCCCGCACCAGC
CCCCAGGCACCGAGAGCACGAGCATGGGCACCAAGCCAGGCCTCCCAGGCTGCTCTTCACGTCCCTTATG
CCACTATCAACACCAGCTGCCGCCCAGCTACTTTGGACACAGCTCACCCCCATGGGGGGCCGTCCTGGTG
GGCGTCACTCCCCACCCACGCTGCACACCGGCCCCAGGGCCCTGCCGCCTGGGCCTCCACACCCATCCCT
GCACGTGGCAGCTTTGTCTCTGTTGAGAATGGACTCTACGCTCAGGCAGGGGAGAGGCCTCCTCACACTG
GTCCCGGCCTCACTCTTTTCCCTGACCCTCGGGGGCCCAGGGCCATGGAAGGACCCTTAGGAGTTCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210470 representing NM_024070
Red=Cloning site Green=Tags(s)

MRTEAQVPALQPPEPGLEGAMGHRTLVLPWVLLTLCVTAGTPEVWVQVRMEATELSSFTIRCGFLGSGSI
SLVTVSWGGPNGAGGTTLAVLHPERGIRQWAPARQARWETQSSISLILEGSGASSPCANTTFCCKFASFP
EGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGILGVSGVLLFGCVYLLHLLRRHKHRPAPRLQPSRTS
PQAPRARAWAPSQASQAALHVPYATINTSCRPATLDTAHPHGGPSWWASLPTHAAHRPQGPAAWASTPIP
ARGSFVSVENGLYAQAGERPPHTGPGLTLFPDPRGPRAMEGPLGVR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024070
ORF Size 978 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024070.1, NM_024070.2, NM_024070.3, NP_076975
RefSeq Size 1587
RefSeq ORF 981
Locus ID 79037
Cytogenetics 7q22.1
Protein Families Transmembrane
MW 34.2 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.