SPTSSB (NM_001040100) Human Tagged ORF Clone

CAT#: RC210453

SPTSSB (Myc-DDK-tagged)-Human chromosome 3 open reading frame 57 (C3orf57)

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name SPTSSB (NM_001040100) Human Tagged ORF Clone
Symbol SPTSSB
Synonyms ADMP; C3orf57; SSSPTB
Vector pCMV6-Entry
Sequence Data
>RC210453 representing NM_001040100
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTTGAGGCGTGTGAAGGAATATTTCTCCTGGCTCTACTATCAATACCAAATCATTAGCTGCTGTG
CTGTTTTAGAGCCCTGGGAGCGATCTATGTTTAACACCATCTTACTAACCATTATTGCTATGGTGGTATA
CACTGCCTATGTCTTTATTCCAATCCACATTCGCCTGGCTTGGGAATTTTTCTCAAAAATATGTGGATAT
CACAGTACAATTTCTAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210453 representing NM_001040100
Red=Cloning site Green=Tags(s)

MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY
HSTISN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001040100
ORF Size 228 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001040100.1, NP_001035189
RefSeq Size 2306
RefSeq ORF 231
Locus ID 165679
Cytogenetics 3q26.1
Protein Families Transmembrane
MW 9 kDa
Gene Summary Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.