Nkx2.2 (NKX2-2) (NM_002509) Human Tagged ORF Clone

CAT#: RC210419

Reviews ()
Write a review

NKX2 (Myc-DDK-tagged)-Human NK2 homeobox 2 (NKX2-2)



  "NM_002509" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "NKX2-2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NKX2-2
Synonyms NKX2.2; NKX2B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210419 representing NM_002509
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCTGACCAACACAAAGACGGGGTTTTCGGTCAAGGACATCTTAGACCTGCCGGACACCAACGATG
AGGAGGGCTCTGTGGCCGAAGGTCCGGAGGAAGAGAACGAGGGGCCCGAGCCAGCCAAGAGGGCCGGGCC
GCTGGGGCAGGGCGCCCTGGACGCGGTGCAGAGCCTGCCCCTGAAGAACCCCTTCTACGACAGCAGCGAC
AACCCGTACACGCGCTGGCTGGCCAGCACCGAGGGCCTTCAGTACTCCCTGCACGGTCTGGCTGCCGGGG
CGCCCCCTCAGGACTCAAGCTCCAAGTCCCCGGAGCCCTCGGCCGACGAGTCACCGGACAATGACAAGGA
GACCCCGGGCGGCGGGGGGGACGCCGGCAAGAAGCGAAAGCGGCGAGTGCTTTTCTCCAAGGCGCAGACC
TACGAGCTGGAGCGGCGCTTTCGGCAGCAGCGGTACCTGTCGGCGCCCGAGCGCGAACACCTGGCCAGCC
TCATCCGCCTCACGCCCACGCAGGTCAAGATCTGGTTCCAGAACCACCGCTACAAGATGAAGCGCGCCCG
GGCCGAGAAAGGTATGGAGGTGACGCCCCTGCCCTCGCCGCGCCGGGTGGCCGTGCCCGTCTTGGTCAGG
GACGGCAAACCATGTCACGCGCTCAAAGCCCAGGACCTGGCAGCCGCCACCTTCCAGGCGGGCATTCCCT
TTTCTGCCTACAGCGCGCAGTCGCTGCAGCACATGCAGTACAACGCCCAGTACAGCTCGGCCAGCACCCC
CCAGTACCCGACAGCACACCCCCTGGTCCAGGCCCAGCAGTGGACTTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210419 representing NM_002509
Red=Cloning site Green=Tags(s)

MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSD
NPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQT
YELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVR
DGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002509
ORF Size 819 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002509.4
RefSeq Size 2092 bp
RefSeq ORF 822 bp
Locus ID 4821
UniProt ID O95096
Cytogenetics 20p11.22
Protein Families Transcription Factors
Protein Pathways Maturity onset diabetes of the young
MW 30 kDa
Gene Summary The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. [provided by RefSeq, Jul 2008]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.