Cannabinoid Receptor I(CNR1) (NM_016083) Human Tagged ORF Clone

CAT#: RC210397

CNR1 (Myc-DDK-tagged)-Human cannabinoid receptor 1 (brain) (CNR1), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cannabinoid Receptor I(CNR1) (NM_016083) Human Tagged ORF Clone
Symbol CNR1
Synonyms CANN6; CB-R; CB1; CB1A; CB1K5; CB1R; CNR
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC210397 representing NM_016083
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTCGATCCTAGATGGCCTTGCAGATACCACCTTCCGCACCATCACCACTGACCTCCTGTACGTGG
GCTCAAATGACATTCAGTACGAAGACATCAAAGGTGACATGGCATCCAAATTAGGGTACTTCCCACAGAA
ATTCCCTTTAACTTCCTTTAGGGGAAGTCCCTTCCAAGAGAAGATGACTGCGGGAGACAACCCCCAGCTA
GTCCCAGCAGACCAGGTGAACATTACAGAATTTTACAACAAGTCTCTCTCGTCCTTCAAGGAGAATGAGG
AGAACATCCAGTGTGGGGAGAACTTCATGGACATAGAGTGTTTCATGGTCCTGAACCCCAGCCAGCAGCT
GGCCATTGCAGTCCTGTCCCTCACGCTGGGCACCTTCACGGTCCTGGAGAACCTCCTGGTGCTGTGCGTC
ATCCTCCACTCCCGCAGCCTCCGCTGCAGGCCTTCCTACCACTTCATCGGCAGCCTGGCGGTGGCAGACC
TCCTGGGGAGTGTCATTTTTGTCTACAGCTTCATTGACTTCCACGTGTTCCACCGCAAAGATAGCCGCAA
CGTGTTTCTGTTCAAACTGGGTGGGGTCACGGCCTCCTTCACTGCCTCCGTGGGCAGCCTGTTCCTCACA
GCCATCGACAGGTACATATCCATTCACAGGCCCCTGGCCTATAAGAGGATTGTCACCAGGCCCAAGGCCG
TGGTGGCGTTTTGCCTGATGTGGACCATAGCCATTGTGATCGCCGTGCTGCCTCTCCTGGGCTGGAACTG
CGAGAAACTGCAATCTGTTTGCTCAGACATTTTCCCACACATTGATGAAACCTACCTGATGTTCTGGATC
GGGGTCACCAGCGTACTGCTTCTGTTCATCGTGTATGCGTACATGTATATTCTCTGGAAGGCTCACAGCC
ACGCCGTCCGCATGATTCAGCGTGGCACCCAGAAGAGCATCATCATCCACACGTCTGAGGATGGGAAGGT
ACAGGTGACCCGGCCAGACCAAGCCCGCATGGACATTAGGTTAGCCAAGACCCTGGTCCTGATCCTGGTG
GTGTTGATCATCTGCTGGGGCCCTCTGCTTGCAATCATGGTGTATGATGTCTTTGGGAAGATGAACAAGC
TCATTAAGACGGTGTTTGCATTCTGCAGTATGCTCTGCCTGCTGAACTCCACCGTGAACCCCATCATCTA
TGCTCTGAGGAGTAAGGACCTGCGACACGCTTTCCGGAGCATGTTTCCCTCTTGTGAAGGCACTGCGCAG
CCTCTGGATAACAGCATGGGGGACTCGGACTGCCTGCACAAACACGCAAACAATGCAGCCAGTGTTCACA
GGGCCGCAGAAAGCTGCATCAAGAGCACGGTCAAGATTGCCAAGGTAACCATGTCTGTGTCCACAGACAC
GTCTGCCGAGGCTCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210397 representing NM_016083
Red=Cloning site Green=Tags(s)

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQL
VPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCV
ILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLT
AIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWI
GVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILV
VLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016083
ORF Size 1416 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016083.1, NM_016083.2, NM_016083.3, NM_016083.4, NP_057167
RefSeq Size 5486
RefSeq ORF 1419
Locus ID 1268
Cytogenetics 6q15
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 52.7 kDa
Gene Summary This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. [provided by RefSeq, May 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)