CKAP4 (NM_006825) Human Tagged ORF Clone

CAT#: RC210270

CKAP4 (Myc-DDK-tagged)-Human cytoskeleton-associated protein 4 (CKAP4)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CKAP4 (NM_006825) Human Tagged ORF Clone
Symbol CKAP4
Synonyms CLIMP-63; ERGIC-63; p63
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC210270 representing NM_006825
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCTCGGCCAAACAAAGGGGCTCCAAGGGCGGCCACGGCGCCGCGAGCCCCTCGGAGAAGGGTGCCC
ACCCGTCGGGCGGCGCGGATGACGTGGCGAAGAAGCCGCCGCCGGCGCCGCAGCAGCCGCCGCCGCCGCC
CGCGCCGCACCCGCAGCAGCACCCGCAGCAGCACCCGCAGAACCAGGCGCACGGCAAGGGCGGCCACCGC
GGCGGCGGCGGCGGCGGCGGCAAGTCCTCCTCCTCCTCCTCCGCCTCCGCCGCCGCTGCCGCCGCCGCCG
CCTCGTCCTCGGCGTCCTGCTCGCGCAGGCTCGGCAGGGCGCTCAACTTTCTCTTCTACCTCGCCCTGGT
GGCGGCGGCCGCTTTCTCGGGCTGGTGCGTCCACCACGTCCTGGAGGAGGTCCAGCAGGTCCGGCGCAGC
CACCAGGACTTCTCCCGGCAGAGGGAGGAGCTGGGCCAGGGCTTGCAGGGCGTCGAGCAGAAGGTGCAGT
CTTTGCAAGCCACATTTGGAACTTTTGAGTCCATCTTGAGAAGCTCCCAACATAAACAAGACCTCACAGA
GAAAGCTGTGAAGCAAGGGGAGAGTGAGGTCAGCCGGATCAGCGAAGTGCTGCAGAAACTCCAGAATGAG
ATTCTCAAAGACCTCTCGGATGGGATCCATGTGGTGAAGGACGCCCGGGAGCGGGACTTCACGTCCCTGG
AGAACACGGTGGAGGAGCGGCTGACGGAGCTCACCAAATCCATCAACGACAACATCGCCATCTTCACAGA
AGTCCAGAAGAGGAGCCAGAAGGAGATCAATGACATGAAGGCAAAGGTTGCCTCCCTGGAAGAATCTGAG
GGGAACAAGCAGGATTTGAAAGCCTTAAAGGAAGCTGTGAAGGAGATACAGACCTCAGCCAAGTCCAGAG
AGTGGGACATGGAGGCCCTGAGAAGTACCCTTCAGACTATGGAGTCTGACATCTACACCGAGGTCCGCGA
GCTGGTGAGCCTCAAGCAGGAGCAGCAGGCTTTCAAGGAGGCGGCCGACACGGAGCGGCTCGCCCTGCAG
GCCCTCACGGAGAAGCTTCTCAGGTCTGAGGAGTCCGTCTCCCGCCTCCCGGAGGAGATCCGGAGACTGG
AGGAAGAGCTCCGCCAGCTGAAGTCCGATTCCCACGGGCCGAAGGAGGACGGAGGCTTCAGACACTCGGA
AGCCTTTGAGGCACTCCAGCAAAAGAGTCAGGGACTGGACTCCAGGCTCCAGCACGTGGAGGATGGGGTG
CTCTCCATGCAGGTGGCTTCTGCGCGCCAGACCGAGAGCCTGGAGTCCCTCCTGTCCAAGAGCCAGGAGC
ACGAGCAGCGCCTGGCCGCCCTGCAGGGGCGCCTGGAAGGCCTCGGGTCCTCAGAGGCAGACCAGGATGG
CCTGGCCAGCACGGTGAGGAGCCTGGGCGAGACCCAGCTGGTGCTCTACGGTGACGTGGAGGAGCTGAAG
AGGAGTGTGGGCGAGCTCCCCAGCACCGTGGAATCACTCCAGAAGGTGCAGGAGCAGGTGCACACGCTGC
TCAGTCAGGACCAAGCCCAGGCCGCCCGTCTGCCTCCTCAGGACTTCCTGGACAGACTTTCTTCTCTAGA
CAACCTGAAAGCCTCAGTCAGCCAAGTGGAGGCGGACTTGAAAATGCTCAGGACTGCTGTGGACAGTTTG
GTTGCATACTCGGTCAAAATAGAAACCAACGAGAACAATCTGGAATCAGCCAAGGGTTTACTAGATGACC
TGAGGAATGATCTGGATAGGTTGTTTGTGAAAGTGGAGAAGATTCACGAAAAGGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210270 representing NM_006825
Red=Cloning site Green=Tags(s)

MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGKGGHR
GGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAAAFSGWCVHHVLEEVQQVRRS
HQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQHKQDLTEKAVKQGESEVSRISEVLQKLQNE
ILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESE
GNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQ
ALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGV
LSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELK
RSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSL
VAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006825
ORF Size 1806 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006825.1, NM_006825.2, NM_006825.3, NP_006816
RefSeq Size 2913
RefSeq ORF 1809
Locus ID 10970
Cytogenetics 12q23.3
Protein Families Transmembrane, Druggable Genome
MW 65.8 kDa
Gene Summary Mediates the anchoring of the endoplasmic reticulum to microtubules. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations