SCARB1 (NM_005505) Human Tagged ORF Clone

CAT#: RC210264

Reviews ()
Write a review

SCARB1 (Myc-DDK-tagged)-Human scavenger receptor class B, member 1 (SCARB1), transcript variant 1



Reconstitution Protocol

USD 474.00

In Stock*

Size
    • 10 ug

Product images

Other products for "SCARB1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SCARB1
Synonyms CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210264 representing NM_005505
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGCTCCGCCAAAGCGCGCTGGGCTGCCGGGGCGCTGGGCGTCGCGGGGCTACTGTGCGCTGTGC
TGGGCGCTGTCATGATCGTGATGGTGCCGTCGCTCATCAAGCAGCAGGTCCTTAAGAACGTGCGCATCGA
CCCCAGTAGCCTGTCCTTCAACATGTGGAAGGAGATCCCTATCCCCTTCTATCTCTCCGTCTACTTCTTT
GACGTCATGAACCCCAGCGAGATCCTGAAGGGCGAGAAGCCGCAGGTGCGGGAGCGCGGGCCCTACGTGT
ACAGGGAGTTCAGGCACAAAAGCAACATCACCTTCAACAACAACGACACCGTGTCCTTCCTCGAGTACCG
CACCTTCCAGTTCCAGCCCTCCAAGTCCCACGGCTCGGAGAGCGACTACATCGTCATGCCCAACATCCTG
GTCTTGGGTGCGGCGGTGATGATGGAGAATAAGCCCATGACCCTGAAGCTCATCATGACCTTGGCATTCA
CCACCCTCGGCGAACGTGCCTTCATGAACCGCACTGTGGGTGAGATCATGTGGGGCTACAAGGACCCCCT
TGTGAATCTCATCAACAAGTACTTTCCAGGCATGTTCCCCTTCAAGGACAAGTTCGGATTATTTGCTGAG
CTCAACAACTCCGACTCTGGGCTCTTCACGGTGTTCACGGGGGTCCAGAACATCAGCAGGATCCACCTCG
TGGACAAGTGGAACGGGCTGAGCAAGGTTGACTTCTGGCATTCCGATCAGTGCAACATGATCAATGGAAC
TTCTGGGCAAATGTGGCCGCCCTTCATGACTCCTGAGTCCTCGCTGGAGTTCTACAGCCCGGAGGCCTGC
CGATCCATGAAGCTAATGTACAAGGAGTCAGGGGTGTTTGAAGGCATCCCCACCTATCGCTTCGTGGCTC
CCAAAACCCTGTTTGCCAACGGGTCCATCTACCCACCCAACGAAGGCTTCTGCCCGTGCCTGGAGTCTGG
AATTCAGAACGTCAGCACCTGCAGGTTCAGTGCCCCCTTGTTTCTCTCCCATCCTCACTTCCTCAACGCC
GACCCGGTTCTGGCAGAAGCGGTGACTGGCCTGCACCCTAACCAGGAGGCACACTCCTTGTTCCTGGACA
TCCACCCGGTCACGGGAATCCCCATGAACTGCTCTGTGAAACTGCAGCTGAGCCTCTACATGAAATCTGT
CGCAGGCATTGGACAAACTGGGAAGATTGAGCCTGTGGTCCTGCCGCTGCTCTGGTTTGCAGAGAGCGGG
GCCATGGAGGGGGAGACTCTTCACACATTCTACACTCAGCTGGTGTTGATGCCCAAGGTGATGCACTATG
CCCAGTACGTCCTCCTGGCGCTGGGCTGCGTCCTGCTGCTGGTCCCTGTCATCTGCCAAATCCGGAGCCA
AGAGAAATGCTATTTATTTTGGAGTAGTAGTAAAAAGGGCTCAAAGGATAAGGAGGCCATTCAGGCCTAT
TCTGAATCCCTGATGACATCAGCTCCCAAGGGCTCTGTGCTGCAGGAAGCAAAACTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210264 representing NM_005505
Red=Cloning site Green=Tags(s)

MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF
DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL
VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE
LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC
RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA
DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQEKCYLFWSSSKKGSKDKEAIQAY
SESLMTSAPKGSVLQEAKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005505
ORF Size 1527 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005505.5
RefSeq Size 2759 bp
RefSeq ORF 1530 bp
Locus ID 949
UniProt ID Q8WTV0
Cytogenetics 12q24.31
Domains CD36
Protein Families Druggable Genome, Transmembrane
MW 56.8 kDa
Gene Summary The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2019]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.