HIF3 alpha(HIF3A) (NM_152795) Human Tagged ORF Clone

CAT#: RC210255

HIF3A (Myc-DDK-tagged)-Human hypoxia inducible factor 3, alpha subunit (HIF3A), transcript variant 3

Need custom modification / cloning service?
Get a free quote

USD 1,030.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name HIF3 alpha(HIF3A) (NM_152795) Human Tagged ORF Clone
Symbol HIF3A
Synonyms bHLHe17; HIF-3A; HIF3-alpha-1; IPAS; MOP7; PASD7
Vector pCMV6-Entry
Sequence Data
>RC210255 representing NM_152795
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTGGGGCTGCAGCGCGCAAGGTCGACCACGGAGCTGCGCAAGGAAAAGTCCCGGGATGCGGCCC
GCAGCCGGCGCAGCCAGGAGACCGAGGTGCTGTACCAGCTGGCTCACACGCTGCCCTTCGCCCGCGGCGT
CAGCGCCCACCTGGACAAGGCCTCTATCATGCGCCTCACCATCAGCTACCTGCGCATGCACCGCCTCTGC
GCCGCAGGGGAGTGGAACCAGGTGGGAGCAGGGGGAGAACCACTGGATGCCTGCTACCTGAAGGCCCTGG
AGGGCTTCGTCATGGTGCTCACCGCCGAGGGAGACATGGCTTACCTGTCGGAGAATGTCAGCAAACACCT
GGGCCTCAGTCAGCTGGAGCTCATTGGACACAGCATCTTTGATTTCATCCACCCCTGTGACCAAGAGGAG
CTTCAGGACGCCCTGACCCCCCAGCAGACCCTGTCCAGGAGGAAGGTGGAGGCCCCCACGGAGCGGTGCT
TCTCCTTGCGCATGAAGAGTACGCTCACCAGCCGCGGGCGCACCCTCAACCTCAAGGCGGCCACCTGGAA
GGTGCTGAACTGCTCTGGACATATGAGGGCCTACAAGCCACCTGCGCAGACTTCTCCAGCTGGGAGCCCT
GACTCAGAGCCCCCGCTGCAGTGCCTGGTGCTCATCTGCGAAGCCATCCCCCACCCAGGCAGCCTGGAGC
CCCCACTGGGCCGAGGGGCCTTCCTCAGCCGCCACAGCCTGGACATGAAGTTCACCTACTGTGACGACAG
GATTGCAGAAGTGGCTGGCTATAGTCCCGATGACCTGATCGGCTGTTCCGCCTACGAGTACATCCACGCG
CTGGACTCCGATGCGGTCAGCAAGAGCATCCACACCTTGCTGAGCAAGGGCCAGGCAGTAACAGGGCAGT
ATCGCTTCCTGGCCCGGAGTGGTGGCTACCTGTGGACCCAGACCCAGGCCACAGTGGTGTCAGGGGGACG
GGGCCCCCAGTCGGAGAGTATCGTCTGTGTCCATTTTTTAATCAGCCAGGTGGAAGAGACCGGAGTGGTG
CTGTCCCTGGAGCAAACGGAGCAACACTCTCGCAGACCCATTCAGCGGGGCGCCCCCTCTCAGAAGGACA
CCCCTAACCCTGGGGACAGCCTTGACACCCCTGGCCCCCGGATCCTTGCCTTCCTGCACCCGCCTTCCCT
GAGCGAGGCTGCCCTGGCCGCTGACCCCCGCCGTTTCTGCAGCCCTGACCTCCGTCGCCTCCTGGGACCC
ATCCTGGATGGGGCTTCAGTAGCAGCCACTCCCAGCACCCCGCTGGCCACACGGCACCCCCAAAGTCCTC
TTTCGGCTGATCTCCCAGATGAACTACCTGTGGGCACCGAGAATGTGCACAGACTCTTCACCTCCGGGAA
AGACACTGAGGCAGTGGAGACAGATTTAGATATAGCTCAGGATGCTGATGCTCTGGATTTGGAGATGCTG
GCCCCCTACATCTCCATGGATGATGACTTCCAGCTCAACGCCAGCGAGCAGCTACCCAGGGCCTACCACA
GACCTCTGGGGGCTGTCCCCCGGCCCCGTGCTCGGAGCTTCCATGGCCTGTCACCTCCAGCCCTTGAGCC
CTCCCTGCTACCCCGCTGGGGGAGTGACCCCCGGCTGAGCTGCTCCAGCCCTTCCAGAGGGGACCCCTCA
GCATCCTCTCCCATGGCTGGGGCTCGGAAGAGGACCCTGGCCCAGAGCTCAGAGGACGAGGACGAGGGAG
TGGAGCTGCTGGGAGTGAGACCTCCCAAAAGGTCCCCCAGCCCAGAACACGAAAACTTTCTGCTCTTTCC
TCTCAGCCTGAGTTTCCTTCTGACAGGAGGACCAGCCCCAGGGAGCCTGCAGGACCCCAGCACCCCACTC
CTGAACCTGAATGAGCCCCTGGGCCTGGGCCCCTCACTGCTCTCTCCGTACTCAGACGAGGACACTACCC
AGCCCGGGGGCCCCTTCCAGCCAAGGGCAGGCTCAGCCCAGGCTGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210255 representing NM_152795
Red=Cloning site Green=Tags(s)

MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTISYLRMHRLC
AAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQLELIGHSIFDFIHPCDQEE
LQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVLNCSGHMRAYKPPAQTSPAGSP
DSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHA
LDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVV
LSLEQTEQHSRRPIQRGAPSQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGP
ILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALDLEML
APYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPRWGSDPRLSCSSPSRGDPS
ASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHENFLLFPLSLSFLLTGGPAPGSLQDPSTPL
LNLNEPLGLGPSLLSPYSDEDTTQPGGPFQPRAGSAQAD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_152795
ORF Size 2007 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_152795.2, NM_152795.3, NP_690008
RefSeq Size 5850
RefSeq ORF 2010
Locus ID 64344
Cytogenetics 19q13.32
Domains PAS, HLH
Protein Families Transcription Factors, Druggable Genome
MW 72.3 kDa
Gene Summary The protein encoded by this gene is the alpha-3 subunit of one of several alpha/beta-subunit heterodimeric transcription factors that regulate many adaptive responses to low oxygen tension (hypoxia). The alpha-3 subunit lacks the transactivation domain found in factors containing either the alpha-1 or alpha-2 subunits. It is thought that factors containing the alpha-3 subunit are negative regulators of hypoxia-inducible gene expression. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)