ADAMDEC1 (NM_014479) Human Tagged ORF Clone

CAT#: RC210181

Reviews ()
Write a review

ADAMDEC1 (Myc-DDK-tagged)-Human ADAM-like, decysin 1 (ADAMDEC1), transcript variant 1



  "NM_014479" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ADAMDEC1 (NM_014479) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ADAMDEC1
Synonyms M12.219
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC210181 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGTGGGATCTCCCAGCTACCTGCAGTGGCCACCATGTCTTGGGTCCTGCTGCCTGTACTTTGGC
TCATTGTTCAAACTCAAGCAATAGCCATAAAGCAAACACCTGAATTAACGCTCCATGAAATAGTTTGTCC
TAAAAAACTTCACATTTTACACAAAAGAGAGATCAAGAACAACCAGACAGAAAAGCATGGCAAAGAGGAA
AGGTATGAACCTGAAGTTCAATATCAGATGATCTTAAATGGAGAAGAAATCATTCTCTCCCTACAAAAAA
CCAAGCACCTCCTGGGGCCAGACTACACTGAAACATTGTACTCACCCAGAGGAGAGGAAATTACCACGAA
ACCTGAGAACATGGAACACTGTTACTATAAAGGAAACATCCTAAATGAAAAGAATTCTGTTGCCAGCATC
AGTACTTGTGACGGGTTGAGAGGATACTTCACACATCATCACCAAAGATACCAGATAAAACCTCTGAAAA
GCACAGACGAGAAAGAACATGCCGTCTTTACATCTAACCAGGAGGAACAAGACCCAGCTAACCACACATG
TGGTGTGAAGAGCACTGACGGGAAACAAGGCCCAATTCGAATCTCTAGATCACTCAAAAGCCCAGAGAAA
GAAGACTTTCTTCGGGCACAGAAATACATTGATCTCTATTTGGTGCTGGATAATGCCTTTTATAAGAACT
ATAATGAGAATCTAACTCTGATAAGAAGCTTTGTGTTTGATGTGATGAACCTACTCAATGTGATATATAA
CACCATAGATGTTCAAGTGGCCTTGGTAGGTATGGAAATCTGGTCTGATGGGGATAAGATAAAGGTGGTG
CCCAGCGCAAGCACCACGTTTGACAACTTCCTGAGATGGCACAGTTCTAACCTGGGGAAAAAGATCCACG
ACCATGCTCAGCTTCTCAGCGGGATTAGCTTCAACAATCGACGTGTGGGACTGGCAGCTTCAAATTCCTT
GTGTTCCCCATCTTCGGTTGCTGTTATTGAGGCTAAAAAAAAGAATAATGTGGCTCTTGTAGGAGTGATG
TCACATGAGCTGGGCCATGTCCTTGGTATGCCTGATGTTCCATTCAACACCAAGTGTCCCTCTGGCAGTT
GTGTGATGAATCAGTATCTGAGTTCAAAATTCCCAAAGGATTTCAGTACATCTTGCCGTGCACATTTTGA
AAGATACCTTTTATCTCAGAAACCAAAGTGCCTGCTGCAAGCACCTATTCCTACAAATATAATGACAACA
CCAGTGTGTGGGAACCACCTTCTAGAAGTGGGAGAAGACTGTGATTGTGGCTCTCCTAAGGAGTGTACCA
ATCTCTGCTGTGAAGCCCTAACGTGTAAACTGAAGCCTGGAACTGATTGCGGAGGAGATGCTCCAAACCA
TACCACAGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210181 protein sequence
Red=Cloning site Green=Tags(s)

MLRGISQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEE
RYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASI
STCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEK
EDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVV
PSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVM
SHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTT
PVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014479
ORF Size 1410 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014479.1, NM_014479.2, NM_014479.3, NP_055294.1
RefSeq Size 2348 bp
RefSeq ORF 1413 bp
Locus ID 27299
Cytogenetics 8p21.2
Protein Families Druggable Genome, Secreted Protein
MW 52.8 kDa
Gene Summary This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells. [provided by RefSeq, Jul 2008]

Citations (2)

Other Versions

Other products for "ADAMDEC1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Anti-ADAMDEC1 Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools