ADAMDEC1 (NM_014479) Human Tagged ORF Clone

CAT#: RC210181

ADAMDEC1 (Myc-DDK-tagged)-Human ADAM-like, decysin 1 (ADAMDEC1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ADAMDEC1 (NM_014479) Human Tagged ORF Clone
Symbol ADAMDEC1
Synonyms M12.219; M12.219
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC210181 representing NM_014479
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGTGGGATCTCCCAGCTACCTGCAGTGGCCACCATGTCTTGGGTCCTGCTGCCTGTACTTTGGC
TCATTGTTCAAACTCAAGCAATAGCCATAAAGCAAACACCTGAATTAACGCTCCATGAAATAGTTTGTCC
TAAAAAACTTCACATTTTACACAAAAGAGAGATCAAGAACAACCAGACAGAAAAGCATGGCAAAGAGGAA
AGGTATGAACCTGAAGTTCAATATCAGATGATCTTAAATGGAGAAGAAATCATTCTCTCCCTACAAAAAA
CCAAGCACCTCCTGGGGCCAGACTACACTGAAACATTGTACTCACCCAGAGGAGAGGAAATTACCACGAA
ACCTGAGAACATGGAACACTGTTACTATAAAGGAAACATCCTAAATGAAAAGAATTCTGTTGCCAGCATC
AGTACTTGTGACGGGTTGAGAGGATACTTCACACATCATCACCAAAGATACCAGATAAAACCTCTGAAAA
GCACAGACGAGAAAGAACATGCCGTCTTTACATCTAACCAGGAGGAACAAGACCCAGCTAACCACACATG
TGGTGTGAAGAGCACTGACGGGAAACAAGGCCCAATTCGAATCTCTAGATCACTCAAAAGCCCAGAGAAA
GAAGACTTTCTTCGGGCACAGAAATACATTGATCTCTATTTGGTGCTGGATAATGCCTTTTATAAGAACT
ATAATGAGAATCTAACTCTGATAAGAAGCTTTGTGTTTGATGTGATGAACCTACTCAATGTGATATATAA
CACCATAGATGTTCAAGTGGCCTTGGTAGGTATGGAAATCTGGTCTGATGGGGATAAGATAAAGGTGGTG
CCCAGCGCAAGCACCACGTTTGACAACTTCCTGAGATGGCACAGTTCTAACCTGGGGAAAAAGATCCACG
ACCATGCTCAGCTTCTCAGCGGGATTAGCTTCAACAATCGACGTGTGGGACTGGCAGCTTCAAATTCCTT
GTGTTCCCCATCTTCGGTTGCTGTTATTGAGGCTAAAAAAAAGAATAATGTGGCTCTTGTAGGAGTGATG
TCACATGAGCTGGGCCATGTCCTTGGTATGCCTGATGTTCCATTCAACACCAAGTGTCCCTCTGGCAGTT
GTGTGATGAATCAGTATCTGAGTTCAAAATTCCCAAAGGATTTCAGTACATCTTGCCGTGCACATTTTGA
AAGATACCTTTTATCTCAGAAACCAAAGTGCCTGCTGCAAGCACCTATTCCTACAAATATAATGACAACA
CCAGTGTGTGGGAACCACCTTCTAGAAGTGGGAGAAGACTGTGATTGTGGCTCTCCTAAGGAGTGTACCA
ATCTCTGCTGTGAAGCCCTAACGTGTAAACTGAAGCCTGGAACTGATTGCGGAGGAGATGCTCCAAACCA
TACCACAGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210181 representing NM_014479
Red=Cloning site Green=Tags(s)

MLRGISQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEE
RYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASI
STCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEK
EDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVV
PSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVM
SHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTT
PVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014479
ORF Size 1410 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014479.1, NM_014479.2, NM_014479.3, NP_055294
RefSeq Size 2175
RefSeq ORF 1413
Locus ID 27299
Cytogenetics 8p21.2
Protein Families Secreted Protein, Druggable Genome
MW 52.6 kDa
Gene Summary This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations