HGD (NM_000187) Human Tagged ORF Clone

CAT#: RC210009

Reviews ()
Write a review

HGD (Myc-DDK-tagged)-Human homogentisate 1,2-dioxygenase (HGD)

  View "NM_000187" in other vectors (7)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name HGD (NM_000187) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HGD
Synonyms AKU; HGO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC210009 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAGTTAAAGTACATTTCTGGATTTGGGAATGAGTGTTCTTCAGAGGATCCTCGCTGCCCAGGTT
CCCTGCCAGAAGGACAGAATAATCCTCAGGTCTGCCCCTACAATCTCTATGCTGAGCAGCTCTCAGGATC
GGCTTTCACTTGTCCACGGAGCACCAATAAGAGAAGCTGGCTGTATAGGATTCTACCTTCAGTTTCTCAC
AAGCCCTTTGAATCCATTGACGAAGGCCATGTCACTCACAACTGGGATGAAGTTGATCCTGATCCTAACC
AGCTTAGATGGAAACCATTTGAGATTCCAAAAGCATCTCAGAAGAAAGTAGACTTTGTGAGTGGCCTGCA
TACCTTGTGTGGAGCTGGAGACATAAAGTCTAACAATGGGCTTGCTATCCACATTTTCCTCTGCAATACC
TCCATGGAGAACAGATGCTTTTACAATTCAGATGGGGACTTCTTGATTGTTCCGCAGAAAGGGAACCTTC
TCATTTACACCGAGTTTGGCAAGATGCTTGTACAGCCCAATGAGATCTGCGTCATTCAGAGAGGAATGCG
GTTCAGCATAGATGTCTTTGAGGAGACCAGGGGCTACATCTTGGAGGTCTATGGTGTCCACTTTGAGTTA
CCTGACCTTGGACCAATTGGGGCCAATGGCTTGGCCAATCCTCGTGATTTCTTGATACCCATTGCCTGGT
ATGAGGATCGCCAAGTACCAGGTGGTTACACGGTCATTAATAAATACCAGGGCAAGCTGTTTGCTGCCAA
ACAGGATGTCTCCCCGTTCAATGTTGTGGCCTGGCACGGGAATTATACACCCTACAAGTACAACCTGAAG
AATTTCATGGTTATCAACTCAGTGGCCTTTGACCATGCAGACCCATCCATTTTCACAGTATTGACTGCTA
AGTCTGTCCGCCCTGGAGTGGCCATTGCTGATTTTGTCATCTTCCCACCTCGATGGGGGGTTGCTGATAA
GACCTTCAGGCCTCCTTATTACCATAGGAACTGCATGAGTGAGTTCATGGGACTCATCCGAGGTCACTAT
GAGGCAAAGCAAGGTGGGTTCCTGCCAGGGGGAGGGAGTCTACACAGCACAATGACCCCCCATGGACCTG
ATGCTGACTGCTTTGAGAAGGCCAGCAAGGTCAAGCTGGCACCTGAGAGGATTGCCGATGGCACCATGGC
ATTTATGTTTGAATCATCTTTAAGTCTGGCGGTCACAAAGTGGGGACTCAAGGCCTCCAGGTGTTTGGAT
GAGAACTACCACAAGTGCTGGGAGCCACTCAAGAGCCACTTCACTCCCAACTCCAGGAACCCAGCAGAAC
CTAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210009 protein sequence
Red=Cloning site Green=Tags(s)

MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSH
KPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNT
SMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFEL
PDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLK
NFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHY
EAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLD
ENYHKCWEPLKSHFTPNSRNPAEPN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000187
ORF Size 1335 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000187.1, NM_000187.2, NM_000187.3, NP_000178.2
RefSeq Size 2012
RefSeq ORF 1338
Locus ID 3081
Cytogenetics 3q13.33
Domains HgmA
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Tyrosine metabolism
MW 50 kDa
Gene Summary This gene encodes the enzyme homogentisate 1,2 dioxygenase. This enzyme is involved in the catabolism of the amino acids tyrosine and phenylalanine. Mutations in this gene are the cause of the autosomal recessive metabolism disorder alkaptonuria. [provided by RefSeq, May 2010]

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-HGD
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones