AK2 (NM_001625) Human Tagged ORF Clone

CAT#: RC209974

AK2 (Myc-DDK-tagged)-Human adenylate kinase 2 (AK2), nuclear gene encoding mitochondrial protein, transcript variant 1

Product Images

Circular map for RC209974

• 

  Western blot validation of overexpression lysate (Cat# LY419835) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC209974 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified AK2 protein (Cat# TP309974). The protein was produced from HEK293T cells transfected with AK2 cDNA clone (Cat# RC209974) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: AK2
• Synonyms: ADK2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC209974 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTCCCAGCGTGCCAGCGGCAGAACCCGAGTATCCTAAAGGCATCCGGGCCGTGCTGCTGGGGCCTC
  CCGGGGCCGGTAAAGGGACCCAGGCACCCAGATTGGCTGAAAACTTCTGTGTCTGCCATTTAGCTACTGG
  GGACATGCTGAGGGCCATGGTGGCTTCTGGCTCAGAGCTAGGAAAAAAGCTGAAGGCAACTATGGATGCT
  GGGAAACTGGTGAGTGATGAAATGGTAGTGGAGCTCATTGAGAAGAATTTGGAGACCCCCTTGTGCAAAA
  ATGGTTTTCTTCTGGATGGCTTCCCTCGGACTGTGAGGCAGGCAGAAATGCTCGATGACCTCATGGAGAA
  GAGGAAAGAGAAGCTTGATTCTGTGATTGAATTCAGCATCCCAGACTCTCTGCTGATCCGAAGAATCACA
  GGAAGGCTGATTCACCCCAAGAGTGGCCGTTCCTACCACGAGGAGTTCAACCCTCCAAAAGAGCCCATGA
  AAGATGACATCACCGGGGAACCCTTGATCCGTCGATCAGATGATAATGAAAAGGCCTTGAAAATCCGCCT
  GCAAGCCTACCACACTCAAACCACCCCACTCATAGAGTACTACAGGAAACGGGGGATCCACTCCGCCATC
  GATGCATCCCAGACCCCCGATGTCGTGTTCGCAAGCATCCTAGCAGCCTTCTCCAAAGCCACATGTAAAG
  ACTTGGTTATGTTTATC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC209974 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA
  GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT
  GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI
  DASQTPDVVFASILAAFSKATCKDLVMFI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001625
• ORF Size: 717 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
• Note: Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required.

Reference Data

• RefSeq: NM_001625.4
• RefSeq Size: 2759 bp
• RefSeq ORF: 720 bp
• Locus ID: 204
• UniProt ID: P54819
• Cytogenetics: 1p35.1
• Domains: ADK, ADK_lid
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism
• MW: 26.5 kDa
• Gene Summary: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.[provided by RefSeq, Nov 2010]