ErbB 3(ERBB3) (NM_001982) Human Tagged ORF Clone

CAT#: RC209954

ERBB3 (Myc-DDK-tagged)-Human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1

Clone Modification / Custom Cloning Service

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ErbB 3(ERBB3) (NM_001982) Human Tagged ORF Clone
Symbol ERBB3
Synonyms c-erbB-3; c-erbB3; ErbB-3; erbB3-S; HER3; LCCS2; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC209954 representing NM_001982
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGCGAACGACGCTCTGCAGGTGCTGGGCTTGCTTTTCAGCCTGGCCCGGGGCTCCGAGGTGGGCA
ACTCTCAGGCAGTGTGTCCTGGGACTCTGAATGGCCTGAGTGTGACCGGCGATGCTGAGAACCAATACCA
GACACTGTACAAGCTCTACGAGAGGTGTGAGGTGGTGATGGGGAACCTTGAGATTGTGCTCACGGGACAC
AATGCCGACCTCTCCTTCCTGCAGTGGATTCGAGAAGTGACAGGCTATGTCCTCGTGGCCATGAATGAAT
TCTCTACTCTACCATTGCCCAACCTCCGCGTGGTGCGAGGGACCCAGGTCTACGATGGGAAGTTTGCCAT
CTTCGTCATGTTGAACTATAACACCAACTCCAGCCACGCTCTGCGCCAGCTCCGCTTGACTCAGCTCACC
GAGATTCTGTCAGGGGGTGTTTATATTGAGAAGAACGATAAGCTTTGTCACATGGACACAATTGACTGGA
GGGACATCGTGAGGGACCGAGATGCTGAGATAGTGGTGAAGGACAATGGCAGAAGCTGTCCCCCCTGTCA
TGAGGTTTGCAAGGGGCGATGCTGGGGTCCTGGATCAGAAGACTGCCAGACATTGACCAAGACCATCTGT
GCTCCTCAGTGTAATGGTCACTGCTTTGGGCCCAACCCCAACCAGTGCTGCCATGATGAGTGTGCCGGGG
GCTGCTCAGGCCCTCAGGACACAGACTGCTTTGCCTGCCGGCACTTCAATGACAGTGGAGCCTGTGTACC
TCGCTGTCCACAGCCTCTTGTCTACAACAAGCTAACTTTCCAGCTGGAACCCAATCCCCACACCAAGTAT
CAGTATGGAGGAGTTTGTGTAGCCAGCTGTCCCCATAACTTTGTGGTGGATCAAACATCCTGTGTCAGGG
CCTGTCCTCCTGACAAGATGGAAGTAGATAAAAATGGGCTCAAGATGTGTGAGCCTTGTGGGGGACTATG
TCCCAAAGCCTGTGAGGGAACAGGCTCTGGGAGCCGCTTCCAGACTGTGGACTCGAGCAACATTGATGGA
TTTGTGAACTGCACCAAGATCCTGGGCAACCTGGACTTTCTGATCACCGGCCTCAATGGAGACCCCTGGC
ACAAGATCCCTGCCCTGGACCCAGAGAAGCTCAATGTCTTCCGGACAGTACGGGAGATCACAGGTTACCT
GAACATCCAGTCCTGGCCGCCCCACATGCACAACTTCAGTGTTTTTTCCAATTTGACAACCATTGGAGGC
AGAAGCCTCTACAACCGGGGCTTCTCATTGTTGATCATGAAGAACTTGAATGTCACATCTCTGGGCTTCC
GATCCCTGAAGGAAATTAGTGCTGGGCGTATCTATATAAGTGCCAATAGGCAGCTCTGCTACCACCACTC
TTTGAACTGGACCAAGGTGCTTCGGGGGCCTACGGAAGAGCGACTAGACATCAAGCATAATCGGCCGCGC
AGAGACTGCGTGGCAGAGGGCAAAGTGTGTGACCCACTGTGCTCCTCTGGGGGATGCTGGGGCCCAGGCC
CTGGTCAGTGCTTGTCCTGTCGAAATTATAGCCGAGGAGGTGTCTGTGTGACCCACTGCAACTTTCTGAA
TGGGGAGCCTCGAGAATTTGCCCATGAGGCCGAATGCTTCTCCTGCCACCCGGAATGCCAACCCATGGAG
GGCACTGCCACATGCAATGGCTCGGGCTCTGATACTTGTGCTCAATGTGCCCATTTTCGAGATGGGCCCC
ACTGTGTGAGCAGCTGCCCCCATGGAGTCCTAGGTGCCAAGGGCCCAATCTACAAGTACCCAGATGTTCA
GAATGAATGTCGGCCCTGCCATGAGAACTGCACCCAGGGGTGTAAAGGACCAGAGCTTCAAGACTGTTTA
GGACAAACACTGGTGCTGATCGGCAAAACCCATCTGACAATGGCTTTGACAGTGATAGCAGGATTGGTAG
TGATTTTCATGATGCTGGGCGGCACTTTTCTCTACTGGCGTGGGCGCCGGATTCAGAATAAAAGGGCTAT
GAGGCGATACTTGGAACGGGGTGAGAGCATAGAGCCTCTGGACCCCAGTGAGAAGGCTAACAAAGTCTTG
GCCAGAATCTTCAAAGAGACAGAGCTAAGGAAGCTTAAAGTGCTTGGCTCGGGTGTCTTTGGAACTGTGC
ACAAAGGAGTGTGGATCCCTGAGGGTGAATCAATCAAGATTCCAGTCTGCATTAAAGTCATTGAGGACAA
GAGTGGACGGCAGAGTTTTCAAGCTGTGACAGATCATATGCTGGCCATTGGCAGCCTGGACCATGCCCAC
ATTGTAAGGCTGCTGGGACTATGCCCAGGGTCATCTCTGCAGCTTGTCACTCAATATTTGCCTCTGGGTT
CTCTGCTGGATCATGTGAGACAACACCGGGGGGCACTGGGGCCACAGCTGCTGCTCAACTGGGGAGTACA
AATTGCCAAGGGAATGTACTACCTTGAGGAACATGGTATGGTGCATAGAAACCTGGCTGCCCGAAACGTG
CTACTCAAGTCACCCAGTCAGGTTCAGGTGGCAGATTTTGGTGTGGCTGACCTGCTGCCTCCTGATGATA
AGCAGCTGCTATACAGTGAGGCCAAGACTCCAATTAAGTGGATGGCCCTTGAGAGTATCCACTTTGGGAA
ATACACACACCAGAGTGATGTCTGGAGCTATGGTGTGACAGTTTGGGAGTTGATGACCTTCGGGGCAGAG
CCCTATGCAGGGCTACGATTGGCTGAAGTACCAGACCTGCTAGAGAAGGGGGAGCGGTTGGCACAGCCCC
AGATCTGCACAATTGATGTCTACATGGTGATGGTCAAGTGTTGGATGATTGATGAGAACATTCGCCCAAC
CTTTAAAGAACTAGCCAATGAGTTCACCAGGATGGCCCGAGACCCACCACGGTATCTGGTCATAAAGAGA
GAGAGTGGGCCTGGAATAGCCCCTGGGCCAGAGCCCCATGGTCTGACAAACAAGAAGCTAGAGGAAGTAG
AGCTGGAGCCAGAACTAGACCTAGACCTAGACTTGGAAGCAGAGGAGGACAACCTGGCAACCACCACACT
GGGCTCCGCCCTCAGCCTACCAGTTGGAACACTTAATCGGCCACGTGGGAGCCAGAGCCTTTTAAGTCCA
TCATCTGGATACATGCCCATGAACCAGGGTAATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGA
GCAGTGAACGGTGCCCCCGTCCAGTCTCTCTACACCCAATGCCACGGGGATGCCTGGCATCAGAGTCATC
AGAGGGGCATGTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGCCGGAGCAGG
AGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTGACTCCTGTTA
CCCCACTCTCCCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTCATGCCAGATACACACCTCAA
AGGTACTCCCTCCTCCCGGGAAGGCACCCTTTCTTCAGTGGGTCTCAGTTCTGTCCTGGGTACTGAAGAA
GAAGATGAAGATGAGGAGTATGAATACATGAACCGGAGGAGAAGGCACAGTCCACCTCATCCCCCTAGGC
CAAGTTCCCTTGAGGAGCTGGGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAG
CACACAGAGTTGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTAT
GAATATATGAATCGGCAACGAGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGGGCCTGCCCAG
CATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGGCCTGGACATCAGGCCCCCCATGTCCATTA
TGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGACTCTGCCTTTGATAACCCTGATTACTGGCAT
AGCAGGCTTTTCCCCAAGGCTAATGCCCAGAGAACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209954 representing NM_001982
Red=Cloning site Green=Tags(s)

MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGH
NADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLT
EILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTIC
APQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKY
QYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDG
FVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPR
RDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPME
GTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCL
GQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVL
ARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAH
IVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAE
PYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKR
ESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSP
SSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSR
SRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEE
EDEDEEYEYMNRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY
EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWH
SRLFPKANAQRT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001982
ORF Size 4026 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001982.1, NM_001982.2, NM_001982.3, NP_001973
RefSeq Size 5511
RefSeq ORF 4029
Locus ID 2065
Cytogenetics 12q13.2
Domains Recep_L_domain, pkinase, TyrKc, S_TKc, Furin-like, FU
Protein Families Protein Kinase, Secreted Protein, Transmembrane, Stem cell - Pluripotency, Adult stem cells, Druggable Genome
Protein Pathways ErbB signaling pathway, Calcium signaling pathway, Endocytosis
MW 148.1 kDa
Gene Summary This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations