C6orf106 (NM_024294) Human Tagged ORF Clone

CAT#: RC209929

C6orf106 (Myc-DDK-tagged)-Human chromosome 6 open reading frame 106 (C6orf106), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name C6orf106 (NM_024294) Human Tagged ORF Clone
Symbol C6orf106
Synonyms dJ391O22.4; FP852
Vector pCMV6-Entry
Sequence Data
>RC209929 representing NM_024294
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGGCATGGACGTAGACCTGGACCCGGAGCTGATGCAGAAGTTCAGCTGCCTGGGCACCACCGACA
AGGACGTGCTCATCTCCGAGTTCCAGAGGCTGCTCGGCTTCCAGCTCAATCCTGCCGGTTGCGCCTTCTT
CCTGGACATGACCAACTGGAACCTACAAGCAGCAATTGGCGCCTATTATGACTTTGAGAGCCCAAACATC
AGTGTGCCCTCTATGTCCTTTGTTGAAGATGTCACCATAGGAGAAGGGGAGTCAATACCTCCGGATACTC
AGTTTGTAAAAACATGGCGGATCCAGAATTCTGGGGCAGAGGCCTGGCCTCCAGGGGTTTGTCTTAAATA
TGTCGGGGGAGACCAATTTGGACATGTGAACATGGTGATGGTGAGATCGCTAGAGCCCCAAGAGATTGCA
GATGTCAGCGTCCAGATGTGCAGCCCCAGCAGAGCAGGAATGTATCAGGGACAGTGGCGGATGTGCACTG
CTACAGGACTCTACTATGGAGATGTCATCTGGGTGATTCTCAGTGTGGAGGTGGGTGGACTTTTAGGAGT
AACGCAGCAGCTGTCATCTTTTGAAACGGAGTTCAACACACAGCCGCATCGTAAGGTAGAAGGAAACTTC
AACCCTTTTGCCTCTCCCCAAAAGAACCGACAATCAGATGAAAACAACTTAAAAGACCCTGGGGGCTCCG
AGTTCGACTCGATCAGCAAAAACACATGGGCTCCTGCTCCTGACACATGGGCTCCTGCTCCTGACCAAAC
TGAGCAAGACCAGAATAGACTGTCACAGAACTCTGTAAATCTGTCTCCCAGCAGTCACGCAAACAACTTA
TCAGTAGTGACTTACAGTAAGGGGCTCCATGGGCCTTACCCCTTCGGCCAGTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209929 representing NM_024294
Red=Cloning site Green=Tags(s)

MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNI
SVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIA
DVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNF
NPFASPQKNRQSDENNLKDPGGSEFDSISKNTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNL
SVVTYSKGLHGPYPFGQS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024294
ORF Size 894 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024294.1, NM_024294.2, NM_024294.3, NP_077270
RefSeq Size 4430
RefSeq ORF 897
Locus ID 64771
Cytogenetics 6p21.31
MW 32.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)