CPSF2 (NM_017437) Human Tagged ORF Clone

CAT#: RC209857

Reviews ()
Write a review

CPSF2 (Myc-DDK-tagged)-Human cleavage and polyadenylation specific factor 2, 100kDa (CPSF2)



  "NM_017437" in other vectors (4)

Reconstitution Protocol

USD 716.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "CPSF2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CPSF2
Synonyms CPSF100
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209857 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGTCTATTATCAAATTAACTACCCTTTCTGGGGTCCAAGAAGAATCTGCCCTTTGCTATCTTCTCC
AAGTTGATGAGTTTAGATTTTTATTGGACTGTGGCTGGGATGAGCACTTTTCTATGGATATTATTGATTC
CCTGAGGAAGCATGTTCACCAGATTGATGCAGTGCTGTTGTCTCACCCTGATCCTCTCCACCTTGGTGCC
CTCCCGTATGCTGTCGGAAAGTTGGGTCTGAACTGTGCTATCTATGCAACCATTCCTGTTTATAAAATGG
GACAGATGTTCATGTATGATCTTTATCAGTCTCGACACAATACAGAAGATTTTACACTCTTTACATTAGA
TGATGTGGATGCAGCCTTTGATAAAATACAGCAGCTAAAATTCTCTCAGATTGTGAATTTGAAAGGTAAA
GGACATGGCCTGTCTATCACACCTCTGCCAGCTGGTCATATGATAGGTGGAACAATATGGAAAATAGTCA
AAGATGGAGAAGAAGAAATTGTTTATGCAGTTGACTTCAACCACAAGAGGGAGATCCATTTAAATGGATG
TTCCCTGGAAATGCTAAGCAGGCCTTCCCTACTTATCACAGATTCATTCAATGCTACATATGTACAGCCT
AGAAGAAAACAGAGAGATGAGCAGCTTCTGACAAATGTCCTGGAAACACTTCGAGGTGATGGAAATGTGT
TAATAGCAGTGGACACAGCAGGCAGAGTTTTGGAACTTGCTCAACTTCTTGATCAGATTTGGAGGACTAA
AGATGCAGGATTGGGTGTTTACTCATTGGCACTCCTAAATAATGTCAGTTACAATGTGGTGGAGTTTTCT
AAGTCCCAGGTAGAATGGATGAGTGGTAAATTGATGAGATGTTTTGAAGACAAAAGAAATAATCCGTTTC
AGTTTCGCCATCTCTCTTTATGTCATGGTCTTTCTGACTTGGCCCGTGTACCTAGCCCTAAAGTTGTACT
TGCCAGCCAACCTGACCTGGAATGCGGATTTTCAAGGGATCTCTTTATTCAGTGGTGTCAGGACCCTAAA
AACTCAATCATTCTAACCTACAGAACTACTCCTGGGACTTTAGCACGTTTCCTAATTGATAATCCTTCTG
AAAAAATTACAGAAATAGAGTTGAGGAAACGTGTGAAGCTTGAAGGGAAAGAACTTGAAGAATACTTGGA
AAAAGAGAAACTAAAGAAAGAAGCTGCCAAAAAGCTTGAGCAGTCAAAAGAGGCAGATATAGATTCCAGT
GATGAGAGTGATATTGAGGAAGATATTGACCAGCCATCAGCTCATAAGACGAAGCATGACTTGATGATGA
AAGGTGAAGGCAGTCGTAAAGGAAGTTTTTTCAAACAGGCAAAAAAGTCCTATCCTATGTTTCCTGCCCC
AGAAGAAAGAATTAAATGGGATGAATATGGAGAGATTATCAAACCAGAGGATTTCTTAGTGCCAGAGCTT
CAAGCTACTGAAGAAGAAAAAAGCAAATTAGAATCTGGTTTGACAAATGGAGATGAACCTATGGATCAGG
ATTTATCTGATGTTCCTACTAAATGTATTTCTACAACAGAGTCTATTGAAATAAAAGCCCGGGTTACCTA
CATAGACTATGAAGGACGCTCTGATGGGGATTCCATTAAAAAAATCATTAATCAGATGAAACCACGACAG
TTGATCATCGTCCATGGCCCACCAGAGGCCAGTCAAGATCTGGCAGAGTGCTGTCGCGCCTTTGGTGGGA
AAGATATTAAAGTGTACATGCCAAAGCTACATGAAACAGTTGATGCCACTAGTGAAACTCACATCTACCA
GGTGAGGTTAAAAGACTCACTTGTCAGCTCTCTTCAGTTTTGTAAGGCAAAAGATGCTGAATTAGCTTGG
ATAGATGGTGTCTTAGATATGAGAGTTTCCAAAGTGGACACAGGGGTTATTTTAGAAGAAGGAGAACTAA
GGGATGATGGAGAAGACTCAGAGATGCAAGTGGAAGCTCCCTCAGATTCTAGCGTTATAGCACAACAAAA
GGCCATGAAAAGTTTGTTCGGAGATGATGAAAAAGAAACAGGTGAAGAAAGTGAGATCATTCCTACTTTG
GAACCCTTGCCACCTCATGAGGTTCCTGGACATCAGTCAGTTTTTATGAATGAACCAAGGCTGTCAGACT
TCAAGCAAGTTCTCTTACGGGAGGGAATTCAAGCTGAATTTGTAGGAGGTGTACTTGTTTGCAACAATCA
AGTAGCAGTCCGCAGAACGGAAACTGGACGCATTGGATTAGAAGGCTGCCTTTGTCAAGATTTTTATAGG
ATAAGAGACCTTTTATATGAACAATATGCCATTGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209857 protein sequence
Red=Cloning site Green=Tags(s)

MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLLSHPDPLHLGA
LPYAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAAFDKIQQLKFSQIVNLKGK
GHGLSITPLPAGHMIGGTIWKIVKDGEEEIVYAVDFNHKREIHLNGCSLEMLSRPSLLITDSFNATYVQP
RRKQRDEQLLTNVLETLRGDGNVLIAVDTAGRVLELAQLLDQIWRTKDAGLGVYSLALLNNVSYNVVEFS
KSQVEWMSGKLMRCFEDKRNNPFQFRHLSLCHGLSDLARVPSPKVVLASQPDLECGFSRDLFIQWCQDPK
NSIILTYRTTPGTLARFLIDNPSEKITEIELRKRVKLEGKELEEYLEKEKLKKEAAKKLEQSKEADIDSS
DESDIEEDIDQPSAHKTKHDLMMKGEGSRKGSFFKQAKKSYPMFPAPEERIKWDEYGEIIKPEDFLVPEL
QATEEEKSKLESGLTNGDEPMDQDLSDVPTKCISTTESIEIKARVTYIDYEGRSDGDSIKKIINQMKPRQ
LIIVHGPPEASQDLAECCRAFGGKDIKVYMPKLHETVDATSETHIYQVRLKDSLVSSLQFCKAKDAELAW
IDGVLDMRVSKVDTGVILEEGELRDDGEDSEMQVEAPSDSSVIAQQKAMKSLFGDDEKETGEESEIIPTL
EPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYR
IRDLLYEQYAIV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017437
ORF Size 2346 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017437.3
RefSeq Size 5072 bp
RefSeq ORF 2349 bp
Locus ID 53981
UniProt ID Q9P2I0
Cytogenetics 14q32.12
MW 88.5 kDa
Gene Summary Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. Involved in the histone 3' end pre-mRNA processing.[UniProtKB/Swiss-Prot Function]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.