VCAM1 (NM_001078) Human Tagged ORF Clone

CAT#: RC209761

Reviews ()
Write a review

VCAM1 (Myc-DDK-tagged)-Human vascular cell adhesion molecule 1 (VCAM1), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol VCAM1
Synonyms CD106; INCAM-100
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209761 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGGGAAGATGGTCGTGATCCTTGGAGCCTCAAATATACTTTGGATAATGTTTGCAGCTTCTCAAG
CTTTTAAAATCGAGACCACCCCAGAATCTAGATATCTTGCTCAGATTGGTGACTCCGTCTCATTGACTTG
CAGCACCACAGGCTGTGAGTCCCCATTTTTCTCTTGGAGAACCCAGATAGATAGTCCACTGAATGGGAAG
GTGACGAATGAGGGGACCACATCTACGCTGACAATGAATCCTGTTAGTTTTGGGAACGAACACTCTTACC
TGTGCACAGCAACTTGTGAATCTAGGAAATTGGAAAAAGGAATCCAGGTGGAGATCTACTCTTTTCCTAA
GGATCCAGAGATTCATTTGAGTGGCCCTCTGGAGGCTGGGAAGCCGATCACAGTCAAGTGTTCAGTTGCT
GATGTATACCCATTTGACAGGCTGGAGATAGACTTACTGAAAGGAGATCATCTCATGAAGAGTCAGGAAT
TTCTGGAGGATGCAGACAGGAAGTCCCTGGAAACCAAGAGTTTGGAAGTAACCTTTACTCCTGTCATTGA
GGATATTGGAAAAGTTCTTGTTTGCCGAGCTAAATTACACATTGATGAAATGGATTCTGTGCCCACAGTA
AGGCAGGCTGTAAAAGAATTGCAAGTCTACATATCACCCAAGAATACAGTTATTTCTGTGAATCCATCCA
CAAAGCTGCAAGAAGGTGGCTCTGTGACCATGACCTGTTCCAGCGAGGGTCTACCAGCTCCAGAGATTTT
CTGGAGTAAGAAATTAGATAATGGGAATCTACAGCACCTTTCTGGAAATGCAACTCTCACCTTAATTGCT
ATGAGGATGGAAGATTCTGGAATTTATGTGTGTGAAGGAGTTAATTTGATTGGGAAAAACAGAAAAGAGG
TGGAATTAATTGTTCAAGAGAAACCATTTACTGTTGAGATCTCCCCTGGACCCCGGATTGCTGCTCAGAT
TGGAGACTCAGTCATGTTGACATGTAGTGTCATGGGCTGTGAATCCCCATCTTTCTCCTGGAGAACCCAG
ATAGACAGCCCTCTGAGCGGGAAGGTGAGGAGTGAGGGGACCAATTCCACGCTGACCCTGAGCCCTGTGA
GTTTTGAGAACGAACACTCTTATCTGTGCACAGTGACTTGTGGACATAAGAAACTGGAAAAGGGAATCCA
GGTGGAGCTCTACTCATTCCCTAGAGATCCAGAAATCGAGATGAGTGGTGGCCTCGTGAATGGGAGCTCT
GTCACTGTAAGCTGCAAGGTTCCTAGCGTGTACCCCCTTGACCGGCTGGAGATTGAATTACTTAAGGGGG
AGACTATTCTGGAGAATATAGAGTTTTTGGAGGATACGGATATGAAATCTCTAGAGAACAAAAGTTTGGA
AATGACCTTCATCCCTACCATTGAAGATACTGGAAAAGCTCTTGTTTGTCAGGCTAAGTTACATATTGAT
GACATGGAATTCGAACCCAAACAAAGGCAGAGTACGCAAACACTTTATGTCAATGTTGCCCCCAGAGATA
CAACCGTCTTGGTCAGCCCTTCCTCCATCCTGGAGGAAGGCAGTTCTGTGAATATGACATGCTTGAGCCA
GGGCTTTCCTGCTCCGAAAATCCTGTGGAGCAGGCAGCTCCCTAACGGGGAGCTACAGCCTCTTTCTGAG
AATGCAACTCTCACCTTAATTTCTACAAAAATGGAAGATTCTGGGGTTTATTTATGTGAAGGAATTAACC
AGGCTGGAAGAAGCAGAAAGGAAGTGGAATTAATTATCCAAGTTACTCCAAAAGACATAAAACTTACAGC
TTTTCCTTCTGAGAGTGTCAAAGAAGGAGACACTGTCATCATCTCTTGTACATGTGGAAATGTTCCAGAA
ACATGGATAATCCTGAAGAAAAAAGCGGAGACAGGAGACACAGTACTAAAATCTATAGATGGCGCCTATA
CCATCCGAAAGGCCCAGTTGAAGGATGCGGGAGTATATGAATGTGAATCTAAAAACAAAGTTGGCTCACA
ATTAAGAAGTTTAACACTTGATGTTCAAGGAAGAGAAAACAACAAAGACTATTTTTCTCCTGAGCTTCTC
GTGCTCTATTTTGCATCCTCCTTAATAATACCTGCCATTGGAATGATAATTTACTTTGCAAGAAAAGCCA
ACATGAAGGGGTCATATAGTCTTGTAGAAGCACAGAAATCAAAAGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209761 protein sequence
Red=Cloning site Green=Tags(s)

MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGK
VTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVA
DVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTV
RQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIA
MRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQ
IDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHID
DMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSE
NATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPE
TWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELL
VLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001078
ORF Size 2217 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001078.2, NP_001069.1
RefSeq Size 3220 bp
RefSeq ORF 2220 bp
Locus ID 7412
UniProt ID P19320
Cytogenetics 1p21.2
Domains ig, IGv, IGc2, IG
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration
MW 81.3 kDa
Gene Summary This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq, Dec 2010]
Other products for "VCAM1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.