AMFR (NM_001144) Human Tagged ORF Clone

CAT#: RC209639

AMFR (Myc-DDK-tagged)-Human autocrine motility factor receptor (AMFR)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AMFR (NM_001144) Human Tagged ORF Clone
Symbol AMFR
Synonyms GP78; RNF45
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC209639 representing NM_001144
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCTGCTCTTCCTCGAGCGCTTCCCCTGGCCCAGCCTCCGCACCTACACGGGCCTCAGCGGCCTGG
CCCTGCTGGGCACCATCATCAGCGCCTACCGCGCGCTCAGCCAGCCCGAGGCCGGCCCCGGCGAGCCGGA
CCAGCTAACGGCCTCGCTGCAGCCTGAGCCGCCGGCGCCCGCCCGGCCGAGCGCCGGGGGACCCCGGGCC
CGCGATGTGGCCCAGTACCTGCTCTCAGACAGCCTCTTCGTGTGGGTTCTAGTAAATACCGCTTGCTGTG
TTTTGATGTTGGTGGCTAAGCTCATCCAGTGTATTGTGTTTGGCCCTCTTCGAGTGAGTGAGAGACAGCA
TCTCAAAGACAAATTTTGGAATTTTATTTTCTACAAGTTCATTTTCATCTTTGGTGTGCTGAATGTCCAG
ACAGTGGAAGAGGTGGTCATGTGGTGCCTCTGGTTTGCCGGACTTGTCTTTCTGCACCTGATGGTTCAGC
TCTGCAAGGATCGATTTGAATATCTTTCCTTCTCGCCCACCACGCCGATGAGCAGCCACGGTCGAGTCCT
GTCCCTGTTGGTTGCCATGCTGCTTTCCTGCTGTGGACTGGCGGCCGTCTGCTCCATCACCGGCTACACC
CACGGAATGCACACCTTGGCTTTCATGGCTGCAGAGTCTCTTCTTGTGACAGTGAGGACTGCTCATGTGA
TTTTACGATACGTAATTCACCTCTGGGACCTCAACCACGAAGGGACGTGGGAAGGAAAGGGGACGTATGT
CTATTACACAGACTTTGTCATGGAGCTCACTCTCCTGTCCCTGGACCTCATGCACCATATTCACATGTTG
TTATTTGGCAACATCTGGTTATCCATGGCCAGCCTGGTCATCTTTATGCAGCTGCGTTACCTGTTTCATG
AGGTGCAACGTCGAATTCGTCGGCACAAGAACTATCTACGTGTGGTTGGAAACATGGAGGCCAGGTTTGC
AGTTGCAACTCCAGAGGAGCTGGCTGTCAACAATGACGACTGTGCCATCTGTTGGGACTCCATGCAGGCT
GCGCGGAAACTGCCCTGTGGACATCTTTTCCACAACTCCTGTCTTCGTTCCTGGCTAGAACAAGACACCT
CCTGTCCAACATGCAGAATGTCTCTTAATATTGCCGACAATAATCGTGTCAGGGAAGAACATCAAGGAGA
GAACTTGGATGAGAATTTGGTTCCTGTAGCAGCAGCCGAAGGGAGACCTCGCTTAAACCAACACAATCAC
TTCTTCCATTTCGATGGGTCTCGGATTGCGAGCTGGCTGCCGAGTTTTTCGGTTGAAGTGATGCACACCA
CCAACATTCTTGGCATTACGCAGGCCAGCAACTCCCAGCTCAATGCAATGGCTCATCAGATTCAAGAGAT
GTTTCCCCAGGTTCCATACCATCTGGTACTGCAGGACCTCCAGCTGACACGCTCAGTTGAAATAACAACA
GACAATATTTTAGAAGGACGGATTCAAGTACCTTTTCCTACACAGCGGTCAGATAGCATCAGACCTGCAT
TGAACAGTCCTGTGGAAAGGCCAAGCAGTGACCAGGAAGAGGGAGAAACTTCTGCTCAGACCGAGCGTGT
GCCACTGGACCTCAGTCCTCGCCTGGAGGAGACGCTGGACTTCGGCGAGGTGGAAGTGGAGCCCAGTGAG
GTGGAAGACTTCGAGGCTCGTGGGAGCCGCTTCTCCAAGTCTGCTGATGAGAGACAGCGCATGCTGGTGC
AGCGTAAGGACGAACTCCTCCAGCAAGCTCGCAAACGTTTCTTGAACAAAAGTTCTGAAGATGATGCGGC
CTCAGAGAGCTTCCTCCCCTCGGAAGGTGCGTCCTCTGACCCCGTGACCCTGCGTCGAAGGATGCTGGCT
GCCGCCGCGGAACGGAGGCTTCAGAAGCAGCAGACCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209639 representing NM_001144
Red=Cloning site Green=Tags(s)

MPLLFLERFPWPSLRTYTGLSGLALLGTIISAYRALSQPEAGPGEPDQLTASLQPEPPAPARPSAGGPRA
RDVAQYLLSDSLFVWVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKDKFWNFIFYKFIFIFGVLNVQ
TVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPMSSHGRVLSLLVAMLLSCCGLAAVCSITGYT
HGMHTLAFMAAESLLVTVRTAHVILRYVIHLWDLNHEGTWEGKGTYVYYTDFVMELTLLSLDLMHHIHML
LFGNIWLSMASLVIFMQLRYLFHEVQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQA
ARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENLVPVAAAEGRPRLNQHNH
FFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITT
DNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLDFGEVEVEPSE
VEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNKSSEDDAASESFLPSEGASSDPVTLRRRMLA
AAAERRLQKQQTS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001144
ORF Size 1929 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001144.2, NM_001144.3, NM_001144.4, NM_001144.5, NP_001135
RefSeq Size 3594
RefSeq ORF 1932
Locus ID 267
Cytogenetics 16q13
Domains RING, CUE
Protein Families Transmembrane, Druggable Genome
MW 72.8 kDa
Gene Summary This locus encodes a glycosylated transmembrane receptor. Its ligand, autocrine motility factor, is a tumor motility-stimulating protein secreted by tumor cells. The encoded receptor is also a member of the E3 ubiquitin ligase family of proteins. It catalyzes ubiquitination and endoplasmic reticulum-associated degradation of specific proteins. [provided by RefSeq, Feb 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations