DNase II (DNASE2) (NM_001375) Human Tagged ORF Clone

CAT#: RC209573

Reviews ()
Write a review

DNASE2 (Myc-DDK-tagged)-Human deoxyribonuclease II, lysosomal (DNASE2)



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "DNASE2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DNASE2
Synonyms DNASE2A; DNL; DNL2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209573 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCCGCTGCTGCTGGCAGCGCTGCTGTGCGTCCCCGCCGGGGCCCTGACCTGCTACGGGGACTCCG
GGCAGCCTGTAGACTGGTTCGTGGTCTACAAGCTGCCAGCTCTTAGAGGGTCCGGGGAGGCGGCGCAGAG
AGGGCTGCAGTACAAGTATCTGGACGAGAGCTCCGGAGGCTGGCGGGACGGCAGGGCACTCATCAACAGC
CCGGAGGGGGCCGTGGGCCGAAGCCTGCAGCCGCTGTACCGGAGCAACACCAGCCAGCTCGCCTTCCTGC
TCTACAATGACCAACCGCCTCAACCCAGCAAGGCTCAGGACTCTTCCATGCGTGGGCACACGAAGGGTGT
CCTGCTCCTTGACCACGATGGGGGCTTCTGGCTGGTCCACAGTGTACCTAACTTCCCTCCACCGGCCTCC
TCTGCTGCATACAGCTGGCCTCATAGCGCCTGTACCTACGGGCAGACCCTGCTCTGTGTGTCTTTTCCCT
TCGCTCAGTTCTCGAAGATGGGCAAGCAGCTGACCTACACCTACCCCTGGGTCTATAACTACCAGCTGGA
AGGGATCTTTGCCCAGGAATTCCCCGACTTGGAGAATGTGGTCAAGGGCCACCACGTTAGCCAAGAACCC
TGGAACAGCAGCATCACACTCACATCCCAGGCCGGGGCTGTTTTCCAGAGCTTTGCCAAGTTCAGCAAAT
TTGGAGATGACCTGTACTCCGGCTGGTTGGCAGCAGCCCTTGGTACCAACCTGCAGGTCCAGTTCTGGCA
CAAAACTGTAGGCATCCTGCCCTCTAACTGCTCGGATATCTGGCAGGTTCTGAATGTGAACCAGATAGCT
TTCCCTGGACCAGCCGGCCCAAGCTTCAACAGCACAGAGGACCACTCCAAATGGTGCGTGTCCCCAAAAG
GGCCCTGGACCTGCGTGGGTGACATGAATCGGAACCAGGGAGAGGAGCAACGGGGTGGGGGCACACTGTG
TGCCCAGCTGCCAGCCCTCTGGAAAGCCTTCCAGCCGCTGGTGAAGAACTACCAGCCCTGTAATGGCATG
GCCAGGAAGCCCAGCAGAGCTTATAAGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209573 protein sequence
Red=Cloning site Green=Tags(s)

MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINS
PEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPAS
SAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEP
WNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIA
FPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM
ARKPSRAYKI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001375
ORF Size 1080 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001375.3
RefSeq Size 2011 bp
RefSeq ORF 1083 bp
Locus ID 1777
UniProt ID O00115
Cytogenetics 19p13.13
Domains DNase_II
Protein Families Druggable Genome
Protein Pathways Lysosome
MW 39.6 kDa
Gene Summary This gene encodes a member of the DNase family. The protein, located in the lysosome, hydrolyzes DNA under acidic conditions and mediates the breakdown of DNA during erythropoiesis and apoptosis. Two codominant alleles have been characterized, DNASE2*L (low activity) and DNASE2*H (high activity), that differ at one nucleotide in the promoter region. The DNASE2*H allele is represented in this record. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.