DNase II(DNASE2) (NM_001375) Human Tagged ORF Clone

CAT#: RC209573

DNASE2 (Myc-DDK-tagged)-Human deoxyribonuclease II, lysosomal (DNASE2)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DNase II(DNASE2) (NM_001375) Human Tagged ORF Clone
Symbol DNASE2
Synonyms DNASE2A; DNL; DNL2
Vector pCMV6-Entry
Sequence Data
>RC209573 representing NM_001375
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCCGCTGCTGCTGGCAGCGCTGCTGTGCGTCCCCGCCGGGGCCCTGACCTGCTACGGGGACTCCG
GGCAGCCTGTAGACTGGTTCGTGGTCTACAAGCTGCCAGCTCTTAGAGGGTCCGGGGAGGCGGCGCAGAG
AGGGCTGCAGTACAAGTATCTGGACGAGAGCTCCGGAGGCTGGCGGGACGGCAGGGCACTCATCAACAGC
CCGGAGGGGGCCGTGGGCCGAAGCCTGCAGCCGCTGTACCGGAGCAACACCAGCCAGCTCGCCTTCCTGC
TCTACAATGACCAACCGCCTCAACCCAGCAAGGCTCAGGACTCTTCCATGCGTGGGCACACGAAGGGTGT
CCTGCTCCTTGACCACGATGGGGGCTTCTGGCTGGTCCACAGTGTACCTAACTTCCCTCCACCGGCCTCC
TCTGCTGCATACAGCTGGCCTCATAGCGCCTGTACCTACGGGCAGACCCTGCTCTGTGTGTCTTTTCCCT
TCGCTCAGTTCTCGAAGATGGGCAAGCAGCTGACCTACACCTACCCCTGGGTCTATAACTACCAGCTGGA
AGGGATCTTTGCCCAGGAATTCCCCGACTTGGAGAATGTGGTCAAGGGCCACCACGTTAGCCAAGAACCC
TGGAACAGCAGCATCACACTCACATCCCAGGCCGGGGCTGTTTTCCAGAGCTTTGCCAAGTTCAGCAAAT
TTGGAGATGACCTGTACTCCGGCTGGTTGGCAGCAGCCCTTGGTACCAACCTGCAGGTCCAGTTCTGGCA
CAAAACTGTAGGCATCCTGCCCTCTAACTGCTCGGATATCTGGCAGGTTCTGAATGTGAACCAGATAGCT
TTCCCTGGACCAGCCGGCCCAAGCTTCAACAGCACAGAGGACCACTCCAAATGGTGCGTGTCCCCAAAAG
GGCCCTGGACCTGCGTGGGTGACATGAATCGGAACCAGGGAGAGGAGCAACGGGGTGGGGGCACACTGTG
TGCCCAGCTGCCAGCCCTCTGGAAAGCCTTCCAGCCGCTGGTGAAGAACTACCAGCCCTGTAATGGCATG
GCCAGGAAGCCCAGCAGAGCTTATAAGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209573 representing NM_001375
Red=Cloning site Green=Tags(s)

MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINS
PEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPAS
SAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEP
WNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIA
FPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM
ARKPSRAYKI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001375
ORF Size 1080 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001375.1, NM_001375.2, NP_001366
RefSeq Size 2011
RefSeq ORF 1083
Locus ID 1777
Cytogenetics 19p13.13
Domains DNase_II
Protein Families Druggable Genome
Protein Pathways Lysosome
MW 39.4 kDa
Gene Summary This gene encodes a member of the DNase family. The protein, located in the lysosome, hydrolyzes DNA under acidic conditions and mediates the breakdown of DNA during erythropoiesis and apoptosis. Two codominant alleles have been characterized, DNASE2*L (low activity) and DNASE2*H (high activity), that differ at one nucleotide in the promoter region. The DNASE2*H allele is represented in this record. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)