DNA Primase (PRIM2) (NM_000947) Human Tagged ORF Clone

CAT#: RC209566

Reviews ()
Write a review

PRIM2 (Myc-DDK-tagged)-Human primase, DNA, polypeptide 2 (58kDa) (PRIM2)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRIM2
Synonyms p58; PRIM2A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209566 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTTTTCTGGAAGAAAGTGGAGGAAGCTGAGGTTGGCAGGTGACCAGAGGAATGCTTCCTACCCTC
ATTGCCTTCAGTTTTACTTGCAGCCACCTTCTGAAAACATATCTTTAATAGAATTTGAAAACTTGGCTAT
TGATAGAGTTAAATTGTTAAAATCAGTTGAAAATCTTGGAGTGAGCTATGTGAAAGGAACTGAACAATAC
CAGAGTAAGTTGGAGAGTGAGCTTCGGAAGCTCAAGTTTTCCTACAGAGAAAACTTAGAAGATGAATATG
AACCACGAAGAAGAGATCATATTTCTCATTTTATTTTGCGGCTTGCTTATTGCCAGTCTGAAGAACTTAG
ACGCTGGTTCATTCAACAAGAAATGGATCTCCTTCGATTTAGATTTAGTATTTTACCCAAGGATAAAATT
CAGGATTTCTTAAAGGATAGCCAATTGCAGTTTGAGGCTATAAGTGATGAAGAGAAGACTCTTCGAGAAC
AGGAGATTGTTGCCTCATCACCAAGTTTAAGTGGACTTAAGTTGGGGTTCGAGTCCATTTATAAGATCCC
TTTTGCTGATGCTCTGGATTTGTTTCGAGGAAGGAAAGTCTATTTGGAAGATGGCTTTGCTTACGTACCA
CTTAAGGACATTGTGGCAATCATCCTGAATGAATTTAGAGCCAAACTGTCCAAGGCTTTGGCATTAACAG
CCAGGTCCTTGCCTGCTGTGCAGTCTGATGAAAGACTTCAGCCTCTGCTCAATCACCTCAGTCATTCCTA
CACTGGCCAAGATTACAGTACCCAGGGAAATGTTGGGAAGATTTCTTTAGATCAGATTGATTTGCTTTCT
ACCAAATCCTTCCCACCTTGCATGCGTCAGTTACATAAAGCCTTGCGGGAAAATCACCATCTTCGTCATG
GAGGCCGAATGCAGTATGGCCTATTTCTGAAGGGCATTGGTTTAACTTTGGAACAGGCATTGCAGTTCTG
GAAGCAAGAATTTATCAAAGGAAAGATGGATCCAGACAAGTTTGATAAAGGTTACTCTTACAACATCCGT
CACAGCTTTGGAAAGGAAGGCAAGAGGACAGACTATACACCTTTCAGTTGCCTGAAGATTATTCTGTCCA
ATCCACCAAGCCAAGGGGATTATCATGGGTGCCCATTCCGTCACAGTGATCCAGAGCTGCTGAAGCAAAA
GTTGCAGTCATACAAGATCTCTCCTGGAGGGATAAGCCAGATTTTGGATTTAGTAAAGGGGACACATTAC
CAGGTAGCCTGTCAAAAATACTTTGAGATGATACACAATGTGGATGATTGTGGCTTTTCTTTGAATCATC
CTAATCAGTTCTTTTGTGAGAGCCAACGTATTCTAAATGGTGGTAAAGACATAAAGAAGGAACCTATCCA
ACCAGAAACTCCTCAACCCAAACCAAGTGTCCAGAAAACCAAGGATGCATCATCTGCTCTGGCCTCTTTA
AATTCCTCTCTGGAAATGGATATGGAAGGACTAGAAGATTACTTTAGTGAAGATTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209566 protein sequence
Red=Cloning site Green=Tags(s)

MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQY
QSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKI
QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVP
LKDIVAIILNEFRAKLSKALALTARSLPAVQSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLS
TKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIR
HSFGKEGKRTDYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY
QVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPIQPETPQPKPSVQKTKDASSALASL
NSSLEMDMEGLEDYFSEDS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000947
ORF Size 1527 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000947.5
RefSeq Size 2322 bp
RefSeq ORF 1530 bp
Locus ID 5558
UniProt ID P49643
Cytogenetics 6p11.2
Domains DNA_primase_lrg
Protein Pathways DNA replication, Metabolic pathways, Purine metabolism, Pyrimidine metabolism
MW 58.8 kDa
Gene Summary This gene encodes the 58 kilodalton subunit of DNA primase, an enzyme that plays a key role in the replication of DNA. The encoded protein forms a heterodimer with a 49 kilodalton subunit. This heterodimer functions as a DNA-directed RNA polymerase to synthesize small RNA primers that are used to create Okazaki fragments on the lagging strand of the DNA. Alternative splicing of this gene results in multiple transcript variants. This gene has a related pseudogene, which is also present on chromosome 6. [provided by RefSeq, Apr 2014]
Other products for "PRIM2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.