RAB22A (NM_020673) Human Tagged ORF Clone

CAT#: RC209511

RAB22A (Myc-DDK-tagged)-Human RAB22A, member RAS oncogene family (RAB22A)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_020673" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Anti-RAB22A rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "RAB22A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RAB22A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209511 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTGAGGGAGCTCAAAGTGTGTCTGCTCGGGGATACAGGTGTAGGTAAATCGAGTATTGTGTGGC
GGTTTGTGGAAGACAGTTTTGATCCAAACATCAACCCAACAATAGGGGCATCTTTTATGACCAAGACTGT
CCAGTACCAAAATGAGCTACATAAATTCCTAATCTGGGATACAGCTGGACAAGAACGATTTCGTGCCTTA
GCACCAATGTACTATCGAGGGTCGGCTGCAGCTATAATCGTTTATGATATCACAAAAGAAGAGACATTTT
CAACATTAAAGAATTGGGTGAAAGAGCTTCGACAGCATGGCCCACCTAATATTGTAGTTGCCATTGCAGG
AAATAAATGTGATCTTATCGATGTAAGAGAAGTCATGGAGAGAGATGCAAAGGACTACGCCGACTCTATT
CATGCAATTTTTGTAGAGACCAGCGCAAAAAACGCGATAAACATAAATGAACTCTTTATAGAAATTAGTC
GAAGAATTCCATCCACTGACGCCAACCTGCCATCTGGCGGTAAGGGCTTCAAACTCCGAAGACAGCCTTC
AGAGCCAAAGCGGAGCTGCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209511 protein sequence
Red=Cloning site Green=Tags(s)

MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL
APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI
HAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020673
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020673.3
RefSeq Size 8702 bp
RefSeq ORF 585 bp
Locus ID 57403
UniProt ID Q9UL26
Cytogenetics 20q13.32
Domains ras, RAN, RAS, RHO, RAB
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 21.9 kDa
Gene Summary The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.