Hexokinase II(HK2) (NM_000189) Human Tagged ORF Clone

CAT#: RC209482

HK2 (Myc-DDK-tagged)-Human hexokinase 2 (HK2)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Hexokinase II(HK2) (NM_000189) Human Tagged ORF Clone
Symbol HK2
Synonyms HKII; HXK2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC209482 representing NM_000189
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTGCCTCGCATCTGCTTGCCTACTTCTTCACGGAGCTCAACCATGACCAAGTGCAGAAGGTTGACC
AGTATCTCTACCACATGCGCCTCTCTGATGAGACCCTCTTGGAGATCTCTAAGCGGTTCCGCAAGGAGAT
GGAGAAAGGGCTTGGAGCCACCACTCACCCTACTGCAGCAGTGAAGATGCTGCCCACCTTTGTGAGGTCC
ACTCCAGATGGGACAGAACACGGAGAGTTCCTGGCTCTGGATCTTGGAGGGACCAACTTCCGTGTGCTTT
GGGTGAAAGTAACGGACAATGGGCTCCAGAAGGTGGAGATGGAGAATCAGATCTATGCCATCCCTGAGGA
CATCATGCGAGGCAGTGGCACCCAGCTGTTTGACCACATTGCCGAATGCCTGGCTAACTTCATGGATAAG
CTACAAATCAAAGACAAGAAGCTCCCACTGGGTTTTACCTTCTCGTTCCCCTGCCACCAGACTAAACTAG
ACGAGAGTTTCCTGGTCTCATGGACCAAGGGATTCAAGTCCAGTGGAGTGGAAGGCAGAGACGTTGTGGC
TCTGATCCGGAAGGCCATCCAGAGGAGAGGGGACTTTGATATCGACATTGTGGCTGTGGTGAATGACACA
GTTGGGACCATGATGACCTGTGGTTATGATGACCACAACTGTGAGATTGGTCTCATTGTGGGCACGGGCA
GCAACGCCTGCTACATGGAAGAGATGCGCCACATCGACATGGTGGAAGGCGATGAGGGGCGGATGTGTAT
CAATATGGAGTGGGGGGCCTTCGGGGACGATGGCTCGCTCAACGACATTCGCACTGAGTTTGACCAGGAG
ATTGACATGGGCTCACTGAACCCGGGAAAGCAACTGTTTGAGAAGATGATCAGTGGGATGTACATGGGGG
AGCTGGTGAGGCTTATCCTGGTGAAGATGGCCAAGGAGGAGCTGCTCTTTGGGGGGAAGCTCAGCCCAGA
GCTTCTCAACACCGGTCGCTTTGAGACCAAAGACATCTCAGACATTGAAGGGGAGAAGGATGGCATCCGG
AAGGCCCGTGAGGTCCTGATGCGGTTGGGCCTGGACCCGACTCAGGAGGACTGCGTGGCCACTCACCGGA
TCTGCCAGATCGTGTCCACACGCTCCGCCAGCCTGTGCGCAGCCACCCTGGCCGCCGTGCTGCAGCGCAT
CAAGGAGAACAAAGGCGAGGAGCGGCTGCGCTCTACTATTGGGGTCGACGGTTCCGTCTACAAGAAACAC
CCCCATTTTGCCAAGCGTCTACATAAGACCGTGCGGCGGCTGGTGCCCGGCTGCGATGTCCGCTTCCTCC
GCTCCGAGGATGGCAGTGGCAAAGGTGCAGCCATGGTGACAGCAGTGGCTTACCGGCTGGCCGATCAACA
CCGTGCCCGCCAGAAGACATTAGAGCATCTGCAGCTGAGCCATGACCAGCTGCTGGAGGTCAAGAGGAGG
ATGAAGGTAGAAATGGAGCGAGGTCTGAGCAAGGAGACTCATGCCAGTGCCCCCGTCAAGATGCTGCCCA
CCTACGTGTGTGCTACCCCGGACGGCACAGAGAAAGGGGACTTCTTGGCCTTGGACCTTGGAGGAACAAA
TTTCCGGGTCCTGCTGGTCCGTGTTCGGAATGGGAAGTGGGGTGGAGTGGAGATGCACAACAAGATCTAC
GCCATCCCGCAGGAGGTCATGCACGGCACCGGGGACGAGCTCTTTGACCACATTGTCCAGTGCATCGCGG
ACTTCCTCGAGTACATGGGCATGAAGGGCGTGTCCCTGCCTCTGGGTTTTACCTTCTCCTTCCCCTGCCA
GCAGAACAGCCTGGACGAGAGCATCCTCCTCAAGTGGACAAAAGGCTTCAAGGCATCTGGCTGCGAGGGC
GAGGACGTGGTGACCCTGCTGAAGGAAGCGATCCACCGGCGAGAGGAGTTTGACCTGGATGTGGTTGCTG
TGGTGAACGACACAGTCGGAACTATGATGACCTGTGGCTTTGAAGACCCTCACTGTGAAGTTGGCCTCAT
TGTTGGCACGGGCAGCAATGCCTGCTACATGGAGGAGATGCGCAACGTGGAACTGGTGGAAGGAGAAGAG
GGGCGGATGTGTGTGAACATGGAATGGGGGGCCTTCGGGGACAATGGATGCCTAGATGACTTCCGCACAG
AATTTGATGTGGCTGTGGATGAGCTTTCACTCAACCCCGGCAAGCAGAGGTTCGAGAAAATGATCAGTGG
AATGTACCTGGGTGAGATTGTCCGTAACATTCTCATCGATTTCACCAAGCGTGGACTACTCTTCCGAGGC
CGCATCTCAGAGCGGCTCAAGACAAGGGGCATCTTTGAAACCAAGTTCTTGTCTCAGATTGAGAGTGACT
GCCTGGCCCTGCTGCAAGTCCGAGCCATCCTGCAACACTTAGGGCTTGAGAGCACCTGTGACGACAGCAT
CATTGTTAAGGAGGTGTGCACTGTGGTGGCCCGGCGGGCAGCCCAGCTCTGTGGCGCAGGCATGGCCGCT
GTGGTGGACAGGATACGAGAAAACCGTGGGCTGGACGCTCTCAAAGTGACAGTGGGTGTGGATGGGACCC
TCTACAAGCTACATCCTCACTTTGCCAAAGTCATGCATGAGACAGTGAAGGACCTGGCTCCGAAATGTGA
TGTGTCTTTCCTGCAGTCAGAGGATGGCAGCGGGAAGGGGGCGGCGCTCATCACTGCTGTGGCCTGCCGC
ATCCGTGAGGCTGGACAGCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209482 representing NM_000189
Red=Cloning site Green=Tags(s)

MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRS
TPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDK
LQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDT
VGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQE
IDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIR
KAREVLMRLGLDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH
PHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLSHDQLLEVKRR
MKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKWGGVEMHNKIY
AIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEG
EDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE
GRMCVNMEWGAFGDNGCLDDFRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRG
RISERLKTRGIFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACR
IREAGQR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000189
ORF Size 2751 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000189.1, NM_000189.2, NM_000189.3, NM_000189.4, NP_000180
RefSeq Size 7109
RefSeq ORF 2754
Locus ID 3099
Cytogenetics 2p12
Domains hexokinase
Protein Families Druggable Genome
Protein Pathways Glycolysis / Gluconeogenesis, Fructose and mannose metabolism, Galactose metabolism, Starch and sucrose metabolism, Amino sugar and nucleotide sugar metabolism, Metabolic pathways, Insulin signaling pathway, Type II diabetes mellitus
MW 102.2 kDa
Gene Summary Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations