Hexokinase II (HK2) (NM_000189) Human Tagged ORF Clone

CAT#: RC209482

Reviews ()
Write a review

HK2 (Myc-DDK-tagged)-Human hexokinase 2 (HK2)



  "NM_000189" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HK2
Synonyms HKII; HXK2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209482 representing NM_000189
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTGCCTCGCATCTGCTTGCCTACTTCTTCACGGAGCTCAACCATGACCAAGTGCAGAAGGTTGACC
AGTATCTCTACCACATGCGCCTCTCTGATGAGACCCTCTTGGAGATCTCTAAGCGGTTCCGCAAGGAGAT
GGAGAAAGGGCTTGGAGCCACCACTCACCCTACTGCAGCAGTGAAGATGCTGCCCACCTTTGTGAGGTCC
ACTCCAGATGGGACAGAACACGGAGAGTTCCTGGCTCTGGATCTTGGAGGGACCAACTTCCGTGTGCTTT
GGGTGAAAGTAACGGACAATGGGCTCCAGAAGGTGGAGATGGAGAATCAGATCTATGCCATCCCTGAGGA
CATCATGCGAGGCAGTGGCACCCAGCTGTTTGACCACATTGCCGAATGCCTGGCTAACTTCATGGATAAG
CTACAAATCAAAGACAAGAAGCTCCCACTGGGTTTTACCTTCTCGTTCCCCTGCCACCAGACTAAACTAG
ACGAGAGTTTCCTGGTCTCATGGACCAAGGGATTCAAGTCCAGTGGAGTGGAAGGCAGAGACGTTGTGGC
TCTGATCCGGAAGGCCATCCAGAGGAGAGGGGACTTTGATATCGACATTGTGGCTGTGGTGAATGACACA
GTTGGGACCATGATGACCTGTGGTTATGATGACCACAACTGTGAGATTGGTCTCATTGTGGGCACGGGCA
GCAACGCCTGCTACATGGAAGAGATGCGCCACATCGACATGGTGGAAGGCGATGAGGGGCGGATGTGTAT
CAATATGGAGTGGGGGGCCTTCGGGGACGATGGCTCGCTCAACGACATTCGCACTGAGTTTGACCAGGAG
ATTGACATGGGCTCACTGAACCCGGGAAAGCAACTGTTTGAGAAGATGATCAGTGGGATGTACATGGGGG
AGCTGGTGAGGCTTATCCTGGTGAAGATGGCCAAGGAGGAGCTGCTCTTTGGGGGGAAGCTCAGCCCAGA
GCTTCTCAACACCGGTCGCTTTGAGACCAAAGACATCTCAGACATTGAAGGGGAGAAGGATGGCATCCGG
AAGGCCCGTGAGGTCCTGATGCGGTTGGGCCTGGACCCGACTCAGGAGGACTGCGTGGCCACTCACCGGA
TCTGCCAGATCGTGTCCACACGCTCCGCCAGCCTGTGCGCAGCCACCCTGGCCGCCGTGCTGCAGCGCAT
CAAGGAGAACAAAGGCGAGGAGCGGCTGCGCTCTACTATTGGGGTCGACGGTTCCGTCTACAAGAAACAC
CCCCATTTTGCCAAGCGTCTACATAAGACCGTGCGGCGGCTGGTGCCCGGCTGCGATGTCCGCTTCCTCC
GCTCCGAGGATGGCAGTGGCAAAGGTGCAGCCATGGTGACAGCAGTGGCTTACCGGCTGGCCGATCAACA
CCGTGCCCGCCAGAAGACATTAGAGCATCTGCAGCTGAGCCATGACCAGCTGCTGGAGGTCAAGAGGAGG
ATGAAGGTAGAAATGGAGCGAGGTCTGAGCAAGGAGACTCATGCCAGTGCCCCCGTCAAGATGCTGCCCA
CCTACGTGTGTGCTACCCCGGACGGCACAGAGAAAGGGGACTTCTTGGCCTTGGACCTTGGAGGAACAAA
TTTCCGGGTCCTGCTGGTCCGTGTTCGGAATGGGAAGTGGGGTGGAGTGGAGATGCACAACAAGATCTAC
GCCATCCCGCAGGAGGTCATGCACGGCACCGGGGACGAGCTCTTTGACCACATTGTCCAGTGCATCGCGG
ACTTCCTCGAGTACATGGGCATGAAGGGCGTGTCCCTGCCTCTGGGTTTTACCTTCTCCTTCCCCTGCCA
GCAGAACAGCCTGGACGAGAGCATCCTCCTCAAGTGGACAAAAGGCTTCAAGGCATCTGGCTGCGAGGGC
GAGGACGTGGTGACCCTGCTGAAGGAAGCGATCCACCGGCGAGAGGAGTTTGACCTGGATGTGGTTGCTG
TGGTGAACGACACAGTCGGAACTATGATGACCTGTGGCTTTGAAGACCCTCACTGTGAAGTTGGCCTCAT
TGTTGGCACGGGCAGCAATGCCTGCTACATGGAGGAGATGCGCAACGTGGAACTGGTGGAAGGAGAAGAG
GGGCGGATGTGTGTGAACATGGAATGGGGGGCCTTCGGGGACAATGGATGCCTAGATGACTTCCGCACAG
AATTTGATGTGGCTGTGGATGAGCTTTCACTCAACCCCGGCAAGCAGAGGTTCGAGAAAATGATCAGTGG
AATGTACCTGGGTGAGATTGTCCGTAACATTCTCATCGATTTCACCAAGCGTGGACTACTCTTCCGAGGC
CGCATCTCAGAGCGGCTCAAGACAAGGGGCATCTTTGAAACCAAGTTCTTGTCTCAGATTGAGAGTGACT
GCCTGGCCCTGCTGCAAGTCCGAGCCATCCTGCAACACTTAGGGCTTGAGAGCACCTGTGACGACAGCAT
CATTGTTAAGGAGGTGTGCACTGTGGTGGCCCGGCGGGCAGCCCAGCTCTGTGGCGCAGGCATGGCCGCT
GTGGTGGACAGGATACGAGAAAACCGTGGGCTGGACGCTCTCAAAGTGACAGTGGGTGTGGATGGGACCC
TCTACAAGCTACATCCTCACTTTGCCAAAGTCATGCATGAGACAGTGAAGGACCTGGCTCCGAAATGTGA
TGTGTCTTTCCTGCAGTCAGAGGATGGCAGCGGGAAGGGGGCGGCGCTCATCACTGCTGTGGCCTGCCGC
ATCCGTGAGGCTGGACAGCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209482 representing NM_000189
Red=Cloning site Green=Tags(s)

MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRS
TPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDK
LQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDT
VGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQE
IDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIR
KAREVLMRLGLDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH
PHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLSHDQLLEVKRR
MKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKWGGVEMHNKIY
AIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEG
EDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE
GRMCVNMEWGAFGDNGCLDDFRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRG
RISERLKTRGIFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACR
IREAGQR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000189
ORF Size 2751 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000189.5
RefSeq Size 7109 bp
RefSeq ORF 2754 bp
Locus ID 3099
UniProt ID P52789
Cytogenetics 2p12
Domains hexokinase
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Metabolic pathways, Starch and sucrose metabolism, Type II diabetes mellitus
MW 102.2 kDa
Gene Summary Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
    • 100 ul

USD 446.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.