DIP2C (NM_014974) Human Tagged ORF Clone

CAT#: RC209325

DIP2C (Myc-DDK-tagged)-Human DIP2 disco-interacting protein 2 homolog C (Drosophila) (DIP2C)

Need custom modification / cloning service?
Get a free quote

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name DIP2C (NM_014974) Human Tagged ORF Clone
Symbol DIP2C
Synonyms KIAA0934; KIAA0934
Vector pCMV6-Entry
Sequence Data
>RC209325 representing NM_014974
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACCGCAGCCTGGAGGGCATGGCGCTGCCCCTGGAGGTGCGGGCGCGCCTGGCCGAGCTGGAGC
TGGAGCTGTCGGAAGGTGACATCACACAAAAAGGATATGAAAAGAAGAGGTCAAAGTTAATTGGAGCCTA
CCTTCCGCAGCCTCCGAGGGTGGACCAAGCTTTGCCGCAAGAACGCCGGGCTCCTGTCACTCCTTCCTCC
GCCTCTCGCTACCACCGCCGACGGTCTTCAGGGTCACGAGATGAGCGCTATCGGTCAGACGTCCACACGG
AAGCTGTCCAGGCGGCTCTGGCCAAACACAAAGAGCGGAAGATGGCAGTGCCTATGCCTTCCAAACGCAG
GTCCCTGGTCGTGCAGACCTCGATGGACGCCTACACCCCTCCAGATACCTCTTCTGGCTCAGAAGATGAA
GGCTCAGTGCAGGGGGACTCCCAGGGCACCCCCACCTCCAGCCAGGGCAGCATCAATATGGAGCACTGGA
TCAGCCAGGCCATCCACGGCTCCACCACGTCCACCACCTCCTCGTCCTCTACGCAGAGCGGGGGCAGCGG
GGCTGCCCACAGGCTGGCGGACGTCATGGCTCAGACCCACATAGAAAATCATTCTGCACCTCCTGACGTA
ACCACGTACACCTCAGAGCACTCGATACAGGTGGAGAGACCGCAGGGTTCCACGGGGTCCCGGACAGCGC
CCAAGTACGGCAACGCCGAGCTCATGGAGACCGGGGATGGAGTACCAGTAAGTAGCCGGGTGTCAGCAAA
AATCCAGCAGCTTGTCAATACCCTCAAACGACCGAAACGACCACCTTTACGAGAATTCTTTGTCGATGAC
TTTGAAGAATTATTAGAAGTTCAACAACCGGATCCGAACCAACCAAAGCCGGAGGGGGCCCAGATGCTGG
CCATGCGCGGAGAGCAGCTGGGCGTGGTCACGAACTGGCCGCCGTCGCTGGAGGCCGCACTGCAGAGGTG
GGGCACCATCTCGCCCAAGGCGCCCTGCCTGACCACCATGGACACCAACGGGAAGCCCCTCTACATCCTC
ACTTACGGCAAGCTGTGGACAAGAAGTATGAAGGTCGCTTACAGCATTCTACACAAATTAGGCACAAAGC
AGGAACCCATGGTCCGGCCTGGAGATAGGGTGGCACTGGTGTTCCCCAACAATGATCCGGCTGCCTTCAT
GGCGGCTTTCTACGGCTGCCTGCTGGCCGAGGTGGTCCCCGTGCCCATCGAGGTGCCACTCACCAGGAAG
GACGCAGGGAGCCAGCAGATAGGTTTCTTGCTTGGAAGCTGTGGAGTTACTGTAGCCTTGACTAGTGACG
CCTGCCATAAAGGACTTCCAAAAAGCCCAACGGGAGAGATCCCACAGTTTAAAGGTTGGCCAAAGCTGCT
GTGGTTTGTCACAGAGTCTAAACATCTCTCCAAACCGCCCCGAGACTGGTTCCCACACATTAAAGATGCC
AATAACGACACTGCGTATATTGAGTACAAGACGTGTAAGGATGGCAGTGTGCTGGGTGTGACGGTGACGA
GGACTGCGCTGCTGACACACTGCCAGGCCCTGACGCAGGCGTGTGGCTACACGGAAGCTGAAACCATTGT
GAATGTGCTGGATTTCAAGAAGGACGTCGGGCTCTGGCATGGCATCCTGACAAGCGTCATGAACATGATG
CATGTGATCAGCATCCCGTACTCGCTGATGAAGGTGAACCCTCTCTCCTGGATCCAGAAGGTCTGCCAGT
ACAAAGCAAAAGTGGCGTGTGTGAAATCGAGGGATATGCATTGGGCATTAGTAGCACACAGAGATCAGAG
AGACATCAACCTCTCCTCTCTGCGAATGCTGATAGTGGCGGACGGCGCGAACCCCTGGTCTATTTCTTCT
TGCGATGCATTTCTCAATGTCTTCCAAAGTAAAGGCCTTCGACAGGAGGTCATCTGTCCTTGTGCCAGCT
CGCCAGAGGCCCTCACTGTGGCCATCCGGAGGCCCACGGATGACAGTAACCAGCCCCCGGGCCGGGGTGT
CCTCTCCATGCATGGACTGACCTATGGGGTCATTCGTGTGGACTCGGAAGAGAAGCTGTCCGTGCTCACC
GTGCAGGATGTCGGCCTCGTGATGCCTGGAGCCATCATGTGTTCAGTGAAGCCAGACGGGGTTCCTCAGC
TGTGCAGAACGGATGAGATCGGGGAGCTGTGTGTGTGTGCAGTTGCGACGGGCACGTCCTACTATGGCCT
CTCTGGCATGACCAAGAACACCTTTGAGGTGTTTCCCATGACAAGCTCCGGGGCTCCGATCAGTGAATAC
CCATTCATAAGGACAGGCTTGCTGGGGTTCGTGGGTCCCGGAGGCCTCGTCTTCGTGGTGGGCAAGATGG
ATGGCCTCATGGTGGTCAGCGGGCGCAGGCACAACGCCGACGACATCGTGGCCACTGCGCTGGCCGTAGA
ACCCATGAAGTTTGTCTACCGGGGAAGGATAGCCGTGTTCTCGGTGACCGTGCTGCACGACGAGAGGATC
GTGATCGTGGCTGAGCAGAGGCCTGACTCCACGGAAGAGGACAGTTTCCAGTGGATGAGCCGTGTGCTGC
AGGCGATTGACAGTATACATCAAGTTGGAGTTTATTGCCTGGCCTTGGTGCCAGCAAACACCCTCCCCAA
AACCCCGCTTGGTGGGATCCATTTATCAGAAACAAAACAGCTTTTTCTGGAGGGCTCTCTGCACCCCTGC
AATGTCCTAATGTGCCCCCACACCTGCGTCACAAACTTGCCTAAGCCTCGACAGAAGCAGCCAGAAATCG
GCCCTGCCTCTGTGATGGTGGGGAACCTGGTCTCTGGGAAGAGAATCGCCCAGGCCAGTGGCAGAGACCT
GGGTCAGATCGAAGATAACGACCAGGCACGCAAGTTCCTGTTCCTCTCAGAGGTCTTGCAGTGGAGAGCA
CAGACCACCCCGGACCACATCCTCTACACGCTGCTCAACTGTCGGGGTGCGATAGCGAACTCGCTGACCT
GCGTGCAGCTGCACAAGAGAGCTGAGAAGATCGCCGTGATGCTGATGGAGAGGGGCCACCTTCAGGACGG
CGACCACGTGGCCTTGGTCTACCCCCCAGGAATAGACCTGATAGCAGCGTTTTATGGTTGCCTGTACGCA
GGCTGTGTGCCAATAACCGTCCGTCCCCCGCACCCACAGAACATCGCGACGACGTTGCCTACCGTCAAGA
TGATTGTGGAGGTGAGTCGCTCTGCCTGTCTGATGACGACACAGCTGATCTGTAAGTTGCTGCGGTCCAG
GGAGGCGGCGGCGGCTGTGGACGTCAGGACGTGGCCCCTCATCCTGGACACAGATGATTTGCCAAAGAAG
CGGCCTGCCCAGATCTGCAAACCTTGCAACCCAGACACTCTTGCATATCTCGACTTCAGCGTGTCCACAA
CTGGGATGCTAGCTGGCGTAAAGATGTCTCACGCAGCCACCAGTGCCTTCTGCCGTTCCATTAAGCTGCA
GTGTGAACTTTACCCCTCTAGAGAAGTGGCCATCTGCCTGGACCCTTACTGTGGACTGGGATTTGTCCTC
TGGTGCCTCTGCAGTGTGTATTCTGGGCACCAGTCCATCCTGATCCCGCCCTCTGAGCTGGAAACCAACC
CCGCCTTGTGGCTTCTTGCCGTGAGTCAGTACAAAGTCCGAGACACGTTTTGCTCCTACTCCGTGATGGA
GCTGTGCACCAAGGGGCTGGGCTCGCAAACAGAGTCCCTCAAGGCGCGAGGGCTGGACTTGTCCCGAGTG
AGGACCTGCGTGGTTGTGGCGGAAGAGAGGCCTCGGATCGCACTCACACAGTCGTTCTCAAAGCTGTTTA
AGGACCTGGGCCTTCACCCGCGGGCCGTCAGCACCTCGTTCGGTTGCAGGGTGAACCTGGCGATTTGCTT
GCAGGGAACCTCAGGACCTGACCCAACCACTGTCTACGTGGACATGAGAGCCCTGAGACACGACAGAGTC
CGCTTAGTGGAAAGAGGATCCCCTCATAGTCTGCCCCTGATGGAATCGGGAAAGATACTTCCAGGGGTTC
GGATTATAATTGCCAACCCAGAAACAAAAGGACCGCTGGGGGACTCACACCTTGGAGAGATTTGGGTTCA
CAGTGCCCACAATGCCAGCGGTTATTTCACTATTTACGGAGACGAATCCCTCCAGTCAGATCACTTCAAC
TCAAGACTAAGTTTTGGAGACACCCAGACCATCTGGGCACGCACAGGCTACTTGGGGTTCCTGCGGAGAA
CTGAGCTCACAGATGCAAATGGAGAGCGCCATGATGCCCTCTACGTGGTAGGGGCACTGGACGAAGCCAT
GGAGCTGCGGGGCATGCGGTACCACCCAATCGACATTGAGACCTCGGTCATCAGAGCCCATAAAAGCGTT
ACGGAATGTGCTGTGTTTACCTGGACAAATTTGTTGGTGGTTGTGGTTGAGCTGGATGGGTCGGAACAAG
AAGCCTTGGACCTGGTTCCCTTGGTGACCAACGTGGTCCTGGAGGAGCACTACCTGATCGTCGGAGTGGT
GGTCGTGGTGGACATCGGCGTCATCCCCATCAACTCCCGTGGGGAGAAGCAGCGCATGCACCTGCGAGAC
GGGTTTTTGGCAGACCAGCTAGACCCCATCTATATGGCCTACAACATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209325 representing NM_014974
Red=Cloning site Green=Tags(s)

MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSS
ASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSMDAYTPPDTSSGSEDE
GSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTSTTSSSSTQSGGSGAAHRLADVMAQTHIENHSAPPDV
TTYTSEHSIQVERPQGSTGSRTAPKYGNAELMETGDGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDD
FEELLEVQQPDPNQPKPEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYIL
TYGKLWTRSMKVAYSILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMAAFYGCLLAEVVPVPIEVPLTRK
DAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDA
NNDTAYIEYKTCKDGSVLGVTVTRTALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMM
HVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISS
CDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPTDDSNQPPGRGVLSMHGLTYGVIRVDSEEKLSVLT
VQDVGLVMPGAIMCSVKPDGVPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEY
PFIRTGLLGFVGPGGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERI
VIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPC
NVLMCPHTCVTNLPKPRQKQPEIGPASVMVGNLVSGKRIAQASGRDLGQIEDNDQARKFLFLSEVLQWRA
QTTPDHILYTLLNCRGAIANSLTCVQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYA
GCVPITVRPPHPQNIATTLPTVKMIVEVSRSACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKK
RPAQICKPCNPDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVL
WCLCSVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRV
RTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRV
RLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFN
SRLSFGDTQTIWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKSV
TECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRD
GFLADQLDPIYMAYNM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014974
ORF Size 4668 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014974.1, NM_014974.2, NP_055789
RefSeq Size 6594
RefSeq ORF 4671
Locus ID 22982
Cytogenetics 10p15.3
Protein Families Transcription Factors
MW 170.6 kDa
Gene Summary This gene encodes a member of the disco-interacting protein homolog 2 family. The protein shares strong similarity with a Drosophila protein which interacts with the transcription factor disco and is expressed in the nervous system. [provided by RefSeq, Oct 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)