Natriuretic Peptide Receptor A (NPR1) (NM_000906) Human Tagged ORF Clone

CAT#: RC209267

Reviews ()
Write a review

NPR1 (Myc-DDK-tagged)-Human natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) (NPR1)



  "NM_000906" in other vectors (6)

Reconstitution Protocol

USD 1,385.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "NPR1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NPR1
Synonyms ANPa; ANPRA; GUC2A; GUCY2A; NPRA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209267 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGGCCCCGGCGCCCCGCTGGCTCCCGCCTGCGCCTGCTCCTGCTCCTGCTGCTGCCGCCGCTGC
TGCTGCTGCTCCGGGGCAGCCACGCGGGCAACCTGACGGTAGCCGTGGTACTGCCGCTGGCCAATACCTC
GTACCCCTGGTCGTGGGCGCGCGTGGGACCCGCCGTGGAGCTGGCCCTGGCCCAGGTGAAGGCGCGCCCC
GACTTGCTGCCGGGCTGGACGGTCCGCACGGTGCTGGGCAGCAGCGAAAACGCGCTGGGCGTCTGCTCCG
ACACCGCAGCGCCCCTGGCCGCGGTGGACCTCAAGTGGGAGCACAACCCCGCTGTGTTCCTGGGCCCCGG
CTGCGTGTACGCCGCCGCCCCAGTGGGGCGCTTCACCGCGCACTGGCGGGTCCCGCTGCTGACCGCCGGC
GCCCCGGCGCTGGGCTTCGGTGTCAAGGACGAGTATGCGCTGACCACCCGCGCGGGGCCCAGCTACGCCA
AGCTGGGGGACTTCGTGGCGGCGCTGCACCGACGGCTGGGCTGGGAGCGCCAAGCGCTCATGCTCTACGC
CTACCGGCCGGGTGACGAAGAGCACTGCTTCTTCCTCGTGGAGGGGCTGTTCATGCGGGTCCGCGACCGC
CTCAATATTACGGTGGACCACCTGGAGTTCGCCGAGGACGACCTCAGCCACTACACCAGGCTGCTGCGGA
CCATGCCGCGCAAAGGCCGAGTTATCTACATCTGCAGCTCCCCTGATGCCTTCAGAACCCTCATGCTCCT
GGCCCTGGAAGCTGGCTTGTGTGGGGAGGACTACGTTTTCTTCCACCTGGATATCTTTGGGCAAAGCCTG
CAAGGTGGACAGGGCCCTGCTCCCCGCAGGCCCTGGGAGAGAGGGGATGGGCAGGATGTCAGTGCCCGCC
AGGCCTTTCAGGCTGCCAAAATCATTACATATAAAGACCCAGATAATCCCGAGTACTTGGAATTCCTGAA
GCAGTTAAAACACCTGGCCTATGAGCAGTTCAACTTCACCATGGAGGATGTCCTGGTGAACACCATCCCA
GCATCCTTCCACGACGGGCTCCTGCTCTATATCCAGGCAGTGACGGAGACTCTGGCACATGGGGGAACTG
TTACTGATGGGGAGAACATCACTCAGCGGATGTGGAACCGAAGCTTTCAAGGTGTGACAGGATACCTGAA
AATTGATAGCAGTGGCGATCGGGAAACAGACTTCTCCCTCTGGGATATGGATCCCGAGAATGGTGCCTTC
AGGGTTGTACTGAACTACAATGGGACTTCCCAAGAGCTGGTGGCTGTGTCGGGGCGCAAACTGAACTGGC
CCCTGGGGTACCCTCCTCCTGACATCCCCAAATGTGGCTTTGACAACGAAGACCCAGCATGCAACCAAGA
TCACCTTTCCACCCTGGAGGTGCTGGCTTTGGTGGGCAGCCTCTCCTTGCTCGGCATTCTGATTGTCTCC
TTCTTCATATACAGGAAGATGCAGCTGGAGAAGGAACTGGCCTCGGAGCTGTGGCGGGTGCGCTGGGAGG
ACGTTGAGCCCAGTAGCCTTGAGAGGCACCTGCGGAGTGCAGGCAGCCGGCTGACCCTGAGCGGGAGAGG
CTCCAATTACGGCTCCCTGCTAACCACAGAGGGCCAGTTCCAAGTCTTTGCCAAGACAGCATATTATAAG
GGCAACCTCGTGGCTGTGAAACGTGTGAACCGTAAACGCATTGAGCTGACACGAAAAGTCCTGTTTGAAC
TGAAGCATATGCGGGATGTGCAGAATGAACACCTGACCAGGTTTGTGGGAGCCTGCACCGACCCCCCCAA
TATCTGCATCCTCACAGAGTACTGTCCCCGTGGGAGCCTGCAGGACATTCTGGAGAATGAGAGCATCACC
CTGGACTGGATGTTCCGGTACTCACTCACCAATGACATCGTCAAGGGCATGCTGTTTCTACACAATGGGG
CTATCTGTTCCCATGGGAACCTCAAGTCATCCAACTGCGTGGTAGATGGGCGCTTTGTGCTCAAGATCAC
CGACTATGGGCTGGAGAGCTTCAGGGACCTGGACCCAGAGCAAGGACACACCGTTTATGCCAAAAAGCTG
TGGACGGCCCCTGAGCTCCTGCGAATGGCTTCACCCCCTGTGCGGGGCTCCCAGGCTGGTGACGTATACA
GCTTTGGGATCATCCTTCAGGAGATTGCCCTGAGGAGTGGGGTCTTCCACGTGGAAGGTTTGGACCTGAG
CCCCAAAGAGATCATCGAGCGGGTGACTCGGGGTGAGCAGCCCCCCTTCCGGCCCTCCCTGGCCCTGCAG
AGTCACCTGGAGGAGTTGGGGCTGCTCATGCAGCGGTGCTGGGCTGAGGACCCACAGGAGAGGCCACCAT
TCCAGCAGATCCGCCTGACGTTGCGCAAATTTAACAGGGAGAACAGCAGCAACATCCTGGACAACCTGCT
GTCCCGCATGGAGCAGTACGCGAACAATCTGGAGGAACTGGTGGAGGAGCGGACCCAGGCATACCTGGAG
GAGAAGCGCAAGGCTGAGGCCCTGCTCTACCAGATCCTGCCTCACTCAGTGGCTGAGCAGCTGAAGCGTG
GGGAGACGGTGCAGGCCGAAGCCTTTGACAGTGTTACCATCTACTTCAGTGACATTGTGGGTTTCACAGC
GCTGTCGGCGGAGAGCACGCCCATGCAGGTGGTGACCCTGCTCAATGACCTGTACACTTGCTTTGATGCT
GTCATAGACAACTTTGATGTGTACAAGGTGGAGACAATTGGCGATGCCTACATGGTGGTGTCAGGGCTCC
CTGTGCGGAACGGGCGGCTACACGCCTGCGAGGTAGCCCGCATGGCCCTGGCACTGCTGGATGCTGTGCG
CTCCTTCCGAATCCGCCACCGGCCCCAGGAGCAGCTGCGCTTGCGCATTGGCATCCACACAGGACCTGTG
TGTGCTGGAGTGGTGGGACTGAAGATGCCCCGTTACTGTCTCTTTGGGGATACAGTCAACACAGCCTCAA
GAATGGAGTCTAATGGGGAAGCCCTGAAGATCCACTTGTCTTCTGAGACCAAGGCTGTCCTGGAGGAGTT
TGGTGGTTTCGAGCTGGAGCTTCGAGGGGATGTAGAAATGAAGGGCAAAGGCAAGGTTCGGACCTACTGG
CTCCTTGGGGAGAGGGGGAGTAGCACCCGAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209267 protein sequence
Red=Cloning site Green=Tags(s)

MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVELALAQVKARP
DLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLTAG
APALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDR
LNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSL
QGGQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDVLVNTIP
ASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVS
FFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYK
GNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESIT
LDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKL
WTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQ
SHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDA
VIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPV
CAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYW
LLGERGSSTRG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000906
ORF Size 3183 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000906.2, NP_000897.2
RefSeq Size 4201 bp
RefSeq ORF 3186 bp
Locus ID 4881
UniProt ID P16066
Cytogenetics 1q21.3
Domains pkinase, CYCc, ANF_receptor
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Purine metabolism, Vascular smooth muscle contraction
MW 119 kDa
Gene Summary Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, and an intracellular region that contains a protein kinase-like domain and a cyclase catalytic domain. GC-A and GC-B function as receptors for natriuretic peptides; they are also referred to as atrial natriuretic peptide receptor A (NPR1) and type B (NPR2; MIM 108961). Also see NPR3 (MIM 108962), which encodes a protein with only the ligand-binding transmembrane and 37-amino acid cytoplasmic domains. NPR1 is a membrane-bound guanylate cyclase that serves as the receptor for both atrial and brain natriuretic peptides (ANP (MIM 108780) and BNP (MIM 600295), respectively).[supplied by OMIM, May 2009]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.