ELOVL2 (NM_017770) Human Tagged ORF Clone

CAT#: RC209232

ELOVL2 (Myc-DDK-tagged)-Human ELOVL fatty acid elongase 2 (ELOVL2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 485.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ELOVL2 (NM_017770) Human Tagged ORF Clone
Symbol ELOVL2
Synonyms SSC2; SSC2
Vector pCMV6-Entry
Sequence Data
>RC209232 representing NM_017770
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACATCTAAAGGCCTTTGATGATGAAATCAATGCTTTTTTGGACAATATGTTTGGACCGCGAGATT
CTCGAGTCAGAGGGTGGTTCATGTTGGACTCTTACCTTCCTACCTTTTTTCTTACTGTCATGTATCTGCT
CTCAATATGGCTGGGTAACAAGTATATGAAGAACAGACCTGCTCTTTCTCTCAGGGGTATCCTCACCTTG
TATAATCTTGGAATCACACTTCTATCCGCGTACATGCTGGCAGAGCTCATTCTCTCCACTTGGGAAGGAG
GCTACAACTTACAGTGTCAAGATCTTACCAGCGCAGGGGAAGCTGACATCCGGGTAGCCAAGGTGCTTTG
GTGGTACTATTTCTCCAAATCAGTAGAGTTCCTGGACACAATTTTCTTCGTTTTGCGGAAAAAAACGAGT
CAGATTACTTTTCTTCATGTATATCATCATGCTTCTATGTTTAACATCTGGTGGTGTGTCTTGAACTGGA
TACCTTGTGGACAAAGTTTCTTTGGACCAACACTGAACAGTTTTATCCACATTCTTATGTACTCCTACTA
TGGACTTTCTGTGTTTCCATCTATGCACAAGTATCTTTGGTGGAAGAAATATCTCACACAGGCTCAGCTG
GTGCAGTTCGTGCTCGCCATCACGCACACCATGAGCGCCGTCGTGAAACCGTGTGGCTTCCCCTTCGGTT
GTCTCATCTTCCAGTCATCTTATATGCTAACGTTAGTCATCCTCTTCTTAAATTTTTACGTTCAGACATA
CCGAAAAAAGCCAATGAAGAAAGATATGCAAGAGCCACCTGCAGGGAAAGAAGTGAAGAATGGTTTTTCC
AAAGCCTACTTCACTGCAGCAAATGGAGTGATGAACAAGAAAGCACAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209232 representing NM_017770
Red=Cloning site Green=Tags(s)

MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTL
YNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTS
QITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQL
VQFVLAITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFS
KAYFTAANGVMNKKAQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_017770
ORF Size 888 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_017770.1, NM_017770.2, NM_017770.3, NP_060240
RefSeq Size 4079
RefSeq ORF 891
Locus ID 54898
Cytogenetics 6p24.2
Domains ELO
Protein Families Transmembrane
Protein Pathways Biosynthesis of unsaturated fatty acids
MW 34.6 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)