eNOS (NOS3) (NM_000603) Human Tagged ORF Clone

CAT#: RC209228

Reviews ()
Write a review

NOS3 (Myc-DDK-tagged)-Human nitric oxide synthase 3 (endothelial cell) (NOS3), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 680.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NOS3
Synonyms ECNOS; eNOS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209228 representing NM_000603.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGGCAACTTGAAGAGCGTGGCCCAGGAGCCTGGGCCACCCTGCGGCCTGGGGCTGGGGCTGGGCCTT
GGGCTGTGCGGCAAGCAGGGCCCAGCCACCCCGGCCCCTGAGCCCAGCCGGGCCCCAGCATCCCTACTC
CCACCAGCGCCAGAACACAGCCCCCCGAGCTCCCCGCTAACCCAGCCCCCAGAGGGGCCCAAGTTCCCT
CGTGTGAAGAACTGGGAGGTGGGGAGCATCACCTATGACACCCTCAGCGCCCAGGCGCAGCAGGATGGG
CCCTGCACCCCAAGACGCTGCCTGGGCTCCCTGGTATTTCCACGGAAACTACAGGGCCGGCCCTCCCCC
GGCCCCCCGGCCCCTGAGCAGCTGCTGAGTCAGGCCCGGGACTTCATCAACCAGTACTACAGCTCCATT
AAGAGGAGCGGCTCCCAGGCCCACGAACAGCGGCTTCAAGAGGTGGAAGCCGAGGTGGCAGCCACAGGC
ACCTACCAGCTTAGGGAGAGCGAGCTGGTGTTCGGGGCTAAGCAGGCCTGGCGCAACGCTCCCCGCTGC
GTGGGCCGGATCCAGTGGGGGAAGCTGCAGGTGTTCGATGCCCGGGACTGCAGGTCTGCACAGGAAATG
TTCACCTACATCTGCAACCACATCAAGTATGCCACCAACCGGGGCAACCTTCGCTCGGCCATCACAGTG
TTCCCGCAGCGCTGCCCTGGCCGAGGAGACTTCCGAATCTGGAACAGCCAGCTGGTGCGCTACGCGGGC
TACCGGCAGCAGGACGGCTCTGTGCGGGGGGACCCAGCCAACGTGGAGATCACCGAGCTCTGCATTCAG
CACGGCTGGACCCCAGGAAACGGTCGCTTCGACGTGCTGCCCCTGCTGCTGCAGGCCCCAGATGAGCCC
CCAGAACTCTTCCTTCTGCCCCCCGAGCTGGTCCTTGAGGTGCCCCTGGAGCACCCCACGCTGGAGTGG
TTTGCAGCCCTGGGCCTGCGCTGGTACGCCCTCCCGGCAGTGTCCAACATGCTGCTGGAAATTGGGGGC
CTGGAGTTCCCCGCAGCCCCCTTCAGTGGCTGGTACATGAGCACTGAGATCGGCACGAGGAACCTGTGT
GACCCTCACCGCTACAACATCCTGGAGGATGTGGCTGTCTGCATGGACCTGGATACCCGGACCACCTCG
TCCCTGTGGAAAGACAAGGCAGCAGTGGAAATCAACGTGGCCGTGCTGCACAGTTACCAGCTAGCCAAA
GTCACCATCGTGGACCACCACGCCGCCACGGCCTCTTTCATGAAGCACCTGGAGAATGAGCAGAAGGCC
AGGGGGGGCTGCCCTGCAGACTGGGCCTGGATCGTGCCCCCCATCTCGGGCAGCCTCACTCCTGTTTTC
CATCAGGAGATGGTCAACTATTTCCTGTCCCCGGCCTTCCGCTACCAGCCAGACCCCTGGAAGGGGAGT
GCCGCCAAGGGCACCGGCATCACCAGGAAGAAGACCTTTAAAGAAGTGGCCAACGCCGTGAAGATCTCC
GCCTCGCTCATGGGCACGGTGATGGCGAAGCGAGTGAAGGCGACAATCCTGTATGGCTCCGAGACCGGC
CGGGCCCAGAGCTACGCACAGCAGCTGGGGAGACTCTTCCGGAAGGCTTTTGATCCCCGGGTCCTGTGT
ATGGATGAGTATGACGTGGTGTCCCTCGAACACGAGACGCTGGTGCTGGTGGTAACCAGCACATTTGGG
AATGGGGATCCCCCGGAGAATGGAGAGAGCTTTGCAGCTGCCCTGATGGAGATGTCCGGCCCCTACAAC
AGCTCCCCTCGGCCGGAACAGCACAAGAGTTATAAGATCCGCTTCAACAGCATCTCCTGCTCAGACCCA
CTGGTGTCCTCTTGGCGGCGGAAGAGGAAGGAGTCCAGTAACACAGACAGTGCAGGGGCCCTGGGCACC
CTCAGGTTCTGTGTGTTCGGGCTCGGCTCCCGGGCATACCCCCACTTCTGCGCCTTTGCTCGTGCGGTG
GACACACGGCTGGAGGAACTGGGCGGGGAGCGGCTGCTGCAGCTGGGCCAGGGCGACGAGCTGTGCGGC
CAGGAGGAGGCCTTCCGAGGCTGGGCCCAGGCTGCCTTCCAGGCCGCCTGTGAGACCTTCTGTGTGGGA
GAGGATGCCAAGGCCGCCGCCCGAGACATCTTCAGCCCCAAACGGAGCTGGAAGCGCCAGAGGTACCGG
CTGAGCGCCCAGGCCGAGGGCCTGCAGTTGCTGCCAGGTCTGATCCACGTGCACAGGCGGAAGATGTTC
CAGGCTACAATCCGCTCAGTGGAAAACCTGCAAAGCAGCAAGTCCACGAGGGCCACCATCCTGGTGCGC
CTGGACACCGGAGGCCAGGAGGGGCTGCAGTACCAGCCGGGGGACCACATAGGTGTCTGCCCGCCCAAC
CGGCCCGGCCTTGTGGAGGCGCTGCTGAGCCGCGTGGAGGACCCGCCGGCGCCCACTGAGCCCGTGGCA
GTAGAGCAGCTGGAGAAGGGCAGCCCTGGTGGCCCTCCCCCCGGCTGGGTGCGGGACCCCCGGCTGCCC
CCGTGCACGCTGCGCCAGGCTCTCACCTTCTTCCTGGACATCACCTCCCCACCCAGCCCTCAGCTCTTG
CGGCTGCTCAGCACCTTGGCAGAAGAGCCCAGGGAACAGCAGGAGCTGGAGGCCCTCAGCCAGGATCCC
CGACGCTACGAGGAGTGGAAGTGGTTCCGCTGCCCCACGCTGCTGGAGGTGCTGGAGCAGTTCCCGTCG
GTGGCGCTGCCTGCCCCACTGCTCCTCACCCAGCTGCCTCTGCTCCAGCCCCGGTACTACTCAGTCAGC
TCGGCACCCAGCACCCACCCAGGAGAGATCCACCTCACTGTAGCTGTGCTGGCATACAGGACTCAGGAT
GGGCTGGGCCCCCTGCACTATGGAGTCTGCTCCACGTGGCTAAGCCAGCTCAAGCCCGGAGACCCTGTG
CCCTGCTTCATCCGGGGGGCTCCCTCCTTCCGGCTGCCACCCGATCCCAGCTTGCCCTGCATCCTGGTG
GGTCCAGGCACTGGCATTGCCCCCTTCCGGGGATTCTGGCAGGAGCGGCTGCATGACATTGAGAGCAAA
GGGCTGCAGCCCACTCCCATGACTTTGGTGTTCGGCTGCCGATGCTCCCAACTTGACCATCTCTACCGC
GACGAGGTGCAGAACGCCCAGCAGCGCGGGGTGTTTGGCCGAGTCCTCACCGCCTTCTCCCGGGAACCT
GACAACCCCAAGACCTACGTGCAGGACATCCTGAGGACGGAGCTGGCTGCGGAGGTGCACCGCGTGCTG
TGCCTCGAGCGGGGCCACATGTTTGTCTGCGGCGATGTTACCATGGCAACCAACGTCCTGCAGACCGTG
CAGCGCATCCTGGCGACGGAGGGCGACATGGAGCTGGACGAGGCCGGCGACGTCATCGGCGTGCTGCGG
GATCAGCAACGCTACCACGAAGACATTTTCGGGCTCACGCTGCGCACCCAGGAGGTGACAAGCCGCATA
CGCACCCAGAGCTTTTCCTTGCAGGAGCGTCAGTTGCGGGGCGCAGTGCCCTGGGCGTTCGACCCTCCC
GGCTCAGACACCAACAGCCCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC209228
Blue=ORF Red=Cloning site Green=Tag(s)

MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFP
RVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSI
KRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEM
FTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQ
HGWTPGNGRFDVLPLLLQAPDEPPELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGG
LEFPAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAK
VTIVDHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKGS
AAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLFRKAFDPRVLC
MDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSISCSDP
LVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCG
QEEAFRGWAQAAFQAACETFCVGEDAKAAARDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMF
QATIRSVENLQSSKSTRATILVRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVA
VEQLEKGSPGGPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDP
RRYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVLAYRTQD
GLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRGFWQERLHDIESK
GLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEVHRVL
CLERGHMFVCGDVTMATNVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRI
RTQSFSLQERQLRGAVPWAFDPPGSDTNSP

myc-FLAG tag

Recombinant protein using RC209228 also available, TP309228
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000603
ORF Size 3609 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 4345 bp
RefSeq ORF 3612 bp
Locus ID 4846
UniProt ID P29474
Cytogenetics 7q36.1
Domains flavodoxin, NAD_binding_1, FAD_binding_1, NO_synthase
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Arginine and proline metabolism, Calcium signaling pathway, Long-term depression, Metabolic pathways, Pathways in cancer, Small cell lung cancer, VEGF signaling pathway
MW 133.3 kDa
Gene Summary Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Oct 2016]
Other products for "NOS3"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.