ADAMTS4 (NM_005099) Human Tagged ORF Clone

CAT#: RC209226

ADAMTS4 (Myc-DDK-tagged)-Human ADAM metallopeptidase with thrombospondin type 1 motif, 4 (ADAMTS4)

Clone Modification / Custom Cloning Service

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ADAMTS4 (NM_005099) Human Tagged ORF Clone
Symbol ADAMTS4
Synonyms ADAMTS-2; ADAMTS-4; ADMP-1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC209226 representing NM_005099
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCAGACAGGCTCGCATCCCGGGAGGGGCTTGGCAGGGCGCTGGCTGTGGGGAGCCCAACCCTGCC
TCCTGCTCCCCATTGTGCCGCTCTCCTGGCTGGTGTGGCTGCTTCTGCTACTGCTGGCCTCTCTCCTGCC
CTCAGCCCGGCTGGCCAGCCCCCTCCCCCGGGAGGAGGAGATCGTGTTTCCAGAGAAGCTCAACGGCAGC
GTCCTGCCTGGCTCGGGCGCCCCTGCCAGGCTGTTGTGCCGCTTGCAGGCCTTTGGGGAGACGCTGCTAC
TAGAGCTGGAGCAGGACTCCGGTGTGCAGGTCGAGGGGCTGACAGTGCAGTACCTGGGCCAGGCGCCTGA
GCTGCTGGGTGGAGCAGAGCCTGGCACCTACCTGACTGGCACCATCAATGGAGATCCGGAGTCGGTGGCA
TCTCTGCACTGGGATGGGGGAGCCCTGTTAGGCGTGTTACAATATCGGGGGGCTGAACTCCACCTCCAGC
CCCTGGAGGGAGGCACCCCTAACTCTGCTGGGGGACCTGGGGCTCACATCCTACGCCGGAAGAGTCCTGC
CAGCGGTCAAGGTCCCATGTGCAACGTCAAGGCTCCTCTTGGAAGCCCCAGCCCCAGACCCCGAAGAGCC
AAGCGCTTTGCTTCACTGAGTAGATTTGTGGAGACACTGGTGGTGGCAGATGACAAGATGGCCGCATTCC
ACGGTGCGGGGCTAAAGCGCTACCTGCTAACAGTGATGGCAGCAGCAGCCAAGGCCTTCAAGCACCCAAG
CATCCGCAATCCTGTCAGCTTGGTGGTGACTCGGCTAGTGATCCTGGGGTCGGGCGAGGAGGGGCCCCAA
GTGGGGCCCAGTGCTGCCCAGACCCTGCGCAGCTTCTGTGCCTGGCAGCGGGGCCTCAACACCCCTGAGA
ACTCGGACCCTGACCACTTTGACACAGCCATTCTGTTTACCCGTCAGGACCTGTGTGGAGTCTCCACTTG
CGACACGCTGGGTATGGCTGATGTGGGCACCGTCTGTGACCCGGCTCGGAGCTGTGCCATTGTGGAGGAT
GATGGGCTCCAGTCAGCCTTCACTGCTGCTCATGAACTGGGTCATGTCTTCAACGTGCTCCATGACAACT
CCAAGCCATGCATCAGTTTGAATGGGCCTTTGAGCACCTCTCGCCATGTCATGGCCCCTGTGATGGCTCA
TGTGGATCCTGAGGAGCCCTGGTCCCCCTGCAGTGCCCGCTTCATCACTGACTTCCTGGACAATGGCTAT
GGGCACTGTCTCTTAGACAAACCAGAGGCTCCATTGCATCTGCCTGTGACTTTCCCTGGCAAGGACTATG
ATGCTGACCGCCAGTGCCAGCTGACCTTCGGGCCCGACTCACGCCATTGTCCACAGCTGCCGCCGCCCTG
TGCTGCCCTCTGGTGCTCTGGCCACCTCAATGGCCATGCCATGTGCCAGACCAAACACTCGCCCTGGGCC
GATGGCACACCCTGCGGGCCCGCACAGGCCTGCATGGGTGGTCGCTGCCTCCACATGGACCAGCTCCAGG
ACTTCAATATTCCACAGGCTGGTGGCTGGGGTCCTTGGGGACCATGGGGTGACTGCTCTCGGACCTGTGG
GGGTGGTGTCCAGTTCTCCTCCCGAGACTGCACGAGGCCTGTCACCCGGAATGGTGGCAAGTACTGTGAG
GGCCGCCGTGCCCGCTTCCGCTCCTGCAACACTGAGGACTGCCCAACTGGCTCAGCCCTGACCTTCCGCG
AGGAGCAGTGTGCTGCCTACAACCACCGCACCGACCTCTTCAAGAGCTTCCCAGGGCCCATGGACTGGGT
TCCTCGCTACACAGGCGTGGCCCCCCAGGACCAGTGCAAACTCACCTGCCAGGCCCAGGCACTGGGCTAC
TACTATGTGCTGGAGCCACGGGTGGTAGATGGGACCCCCTGTTCCCCGGACAGCTCCTCGGTCTGTGTCC
AGGGCCGATGCATCCATGCTGGCTGTGATCGCATCATTGGCTCCAAGAAGAAGTTTGACAAGTGCATGGT
GTGCGGAGGGGACGGTTCTGGTTGCAGCAAGCAGTCAGGCTCCTTCAGGAAATTCAGGTACGGATACAAC
AATGTGGTCACTATCCCCGCGGGGGCCACCCACATTCTTGTCCGGCAGCAGGGAAACCCTGGCCACCGGA
GCATCTACTTGGCCCTGAAGCTGCCAGATGGCTCCTATGCCCTCAATGGTGAATACACGCTGATGCCCTC
CCCCACAGATGTGGTACTGCCTGGGGCAGTCAGCTTGCGCTACAGCGGGGCCACTGCAGCCTCAGAGACA
CTGTCAGGCCATGGGCCACTGGCCCAGCCTTTGACACTGCAAGTCCTAGTGGCTGGCAACCCCCAGGACA
CACGCCTCCGATACAGCTTCTTCGTGCCCCGGCCGACCCCTTCAACGCCACGCCCCACTCCCCAGGACTG
GCTGCACCGAAGAGCACAGATTCTGGAGATCCTTCGGCGGCGCCCCTGGGCGGGCAGGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209226 representing NM_005099
Red=Cloning site Green=Tags(s)

MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEEIVFPEKLNGS
VLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVA
SLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCNVKAPLGSPSPRPRRA
KRFASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQ
VGPSAAQTLRSFCAWQRGLNTPENSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVED
DGLQSAFTAAHELGHVFNVLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWA
DGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGVQFSSRDCTRPVTRNGGKYCE
GRRARFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSFPGPMDWVPRYTGVAPQDQCKLTCQAQALGY
YYVLEPRVVDGTPCSPDSSSVCVQGRCIHAGCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYN
NVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASET
LSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005099
ORF Size 2511 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005099.1, NM_005099.2, NM_005099.3, NM_005099.4, NM_005099.5, NP_005090
RefSeq Size 4342
RefSeq ORF 2514
Locus ID 9507
Cytogenetics 1q23.3
Protein Families Secreted Protein, Transmembrane, Protease, Druggable Genome
MW 90 kDa
Gene Summary Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Could also be a critical factor in the exacerbation of neurodegeneration in Alzheimer disease. Cleaves aggrecan at the '392-Glu-|-Ala-393' site. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)