TRIB1 (NM_025195) Human Tagged ORF Clone

CAT#: RC209219

Reviews ()
Write a review

TRIB1 (Myc-DDK-tagged)-Human tribbles homolog 1 (Drosophila) (TRIB1)



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "TRIB1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRIB1
Synonyms C8FW; GIG-2; GIG2; SKIP1; TRB-1; TRB1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209219 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGGTCGGTCCGGTGCGCTCTGCCATGAGCGGCGCCTCGCAGCCCCGCGGCCCGGCCCTGCTCTTCC
CAGCCACCCGAGGCGTCCCGGCCAAACGCCTGCTGGACGCCGACGACGCGGCGGCTGTGGCGGCCAAGTG
CCCGCGCCTCTCCGAGTGCTCCAGCCCCCCGGACTACCTCAGCCCCCCCGGCTCGCCCTGCAGTCCGCAG
CCCCCGCCTGCCGCTCCGGGGGCCGGCGGAGGCTCCGGGAGCGCGCCGGGGCCCAGCCGCATCGCCGACT
ACCTGCTGCTGCCCCTAGCCGAGCGCGAGCATGTGTCCCGGGCGCTGTGCATCCACACTGGACGCGAGCT
GCGCTGCAAGGTGTTTCCCATTAAACACTACCAGGACAAAATCAGGCCTTACATCCAGCTGCCATCGCAC
AGCAACATTACTGGCATTGTGGAAGTGATCCTTGGGGAAACCAAGGCCTATGTCTTCTTTGAGAAGGACT
TTGGGGACATGCACTCCTATGTGCGAAGCCGGAAGAGGCTGCGGGAAGAGGAAGCCGCCCGGCTCTTCAA
GCAGATTGTCTCCGCCGTCGCCCACTGCCACCAGTCAGCCATCGTGCTGGGGGACCTGAAGCTTAGGAAG
TTCGTCTTCTCCACGGAGGAGAGAACCCAGCTTAGACTAGAAAGTCTAGAAGACACACACATAATGAAGG
GGGAAGATGATGCTTTGTCAGACAAACATGGCTGCCCAGCCTACGTGAGCCCTGAGATCCTCAACACCAC
TGGGACCTACTCCGGAAAGGCTGCGGACGTTTGGAGCCTGGGGGTGATGCTCTACACCCTTCTGGTTGGA
CGATACCCCTTCCATGACTCAGACCCCAGTGCCCTTTTCTCCAAAATTCGGCGTGGACAGTTCTGCATTC
CTGAGCACATTTCCCCCAAAGCCAGGTGCCTCATTCGCAGCCTCTTGAGACGGGAGCCCTCCGAGAGACT
CACTGCCCCCGAGATCCTACTGCACCCCTGGTTTGAGTCCGTCTTGGAACCCGGGTACATCGACTCAGAA
ATAGGAACTTCAGACCAGATTGTTCCAGAGTACCAGGAGGACAGTGACATTAGTTCCTTCTTCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209219 protein sequence
Red=Cloning site Green=Tags(s)

MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQ
PPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSH
SNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK
FVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVG
RYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSE
IGTSDQIVPEYQEDSDISSFFC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025195
ORF Size 1116 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025195.4
RefSeq Size 3649 bp
RefSeq ORF 1119 bp
Locus ID 10221
UniProt ID Q96RU8
Cytogenetics 8q24.13
Domains pkinase, S_TKc
Protein Families Druggable Genome, Protein Kinase
MW 41 kDa
Gene Summary Adapter protein involved in protein degradation by interacting with COP1 ubiquitin ligase (PubMed:27041596). The COP1-binding motif is masked by autoinhibitory interactions with the protein kinase domain (PubMed:26455797). Serves to alter COP1 substrate specificity by directing the activity of COP1 toward CEBPA (PubMed:27041596). Binds selectively the recognition sequence of CEBPA (PubMed:26455797). Regulates myeloid cell differentiation by altering the expression of CEBPA in a COP1-dependent manner (By similarity). Controls macrophage, eosinophil and neutrophil differentiation via the COP1-binding domain (By similarity). Interacts with MAPK kinases and regulates activation of MAP kinases, but has no kinase activity (PubMed:15299019, PubMed:26455797).[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.