AGO1 (NM_012199) Human Tagged ORF Clone

CAT#: RC209163

AGO1 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 2C, 1 (EIF2C1)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AGO1 (NM_012199) Human Tagged ORF Clone
Symbol AGO1
Synonyms EIF2C; EIF2C1; GERP95; Q99
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC209163 representing NM_012199
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGCGGGACCCTCGGGAGCAGCTGCGGGCGCTTACCTGCCCCCCCTGCAGCAGGTGTTCCAGGCAC
CTCGCCGGCCTGGCATTGGCACTGTGGGGAAACCAATCAAGCTCCTGGCCAATTACTTTGAGGTGGACAT
CCCTAAGATCGACGTGTACCACTACGAGGTGGACATCAAGCCGGATAAGTGTCCCCGTAGAGTCAACCGG
GAAGTGGTGGAATACATGGTCCAGCATTTCAAGCCTCAGATCTTTGGTGATCGCAAGCCTGTGTATGATG
GAAAGAAGAACATTTACACTGTCACAGCACTGCCCATTGGCAACGAACGGGTCGACTTTGAGGTGACAAT
CCCTGGGGAAGGGAAGGATCGAATCTTTAAGGTCTCCATCAAGTGGCTAGCCATTGTGAGCTGGCGAATG
CTGCATGAGGCCCTGGTCAGCGGCCAGATCCCTGTTCCCTTGGAGTCTGTGCAAGCCCTGGATGTGGCCA
TGAGGCACCTGGCATCCATGAGGTACACCCCTGTGGGCCGCTCCTTCTTCTCACCGCCTGAGGGCTACTA
CCACCCGCTGGGGGGTGGGCGCGAGGTCTGGTTCGGCTTTCACCAGTCTGTGCGCCCTGCCATGTGGAAG
ATGATGCTCAACATTGATGTCTCAGCCACTGCCTTTTATAAGGCACAGCCAGTGATTGAGTTCATGTGTG
AGGTGCTGGACATCAGGAACATAAATGAGCAGCCCAAGCCCCTCACGGACTCTCAGCGCGTTCGCTTCAC
CAAGGAGATCAAGGGCCTGAAGGTGGAAGTCACCCACTGTGGACAGATGAAGAGGAAGTACCGCGTGTGT
AATGTTACCCGTCGCCCTGCTAGCCATCAGACATTCCCCTTACAGCTGGAGAGTGGACAGACTGTGGAGT
GCACAGTGGCACAGTATTTCAAGCAGAAATATAACCTTCAGCTCAAGTATCCCCATCTGCCCTGCCTACA
AGTTGGCCAGGAACAAAAGCATACCTACCTTCCCCTAGAGGTCTGTAACATTGTGGCTGGGCAGCGCTGT
ATTAAAAAGCTGACCGACAACCAGACCTCGACCATGATAAAGGCCACAGCTAGATCCGCTCCAGACAGAC
AGGAGGAGATCAGTCGCCTGATGAAGAATGCCAGCTACAACTTAGATCCCTACATCCAGGAATTTGGGAT
CAAAGTGAAGGATGACATGACGGAGGTGACAGGGCGAGTGCTGCCGGCGCCCATCTTGCAGTACGGCGGC
CGGAACCGGGCCATTGCCACACCCAATCAGGGTGTCTGGGACATGCGGGGGAAACAGTTCTACAATGGGA
TTGAGATCAAAGTCTGGGCCATCGCCTGCTTCGCACCCCAAAAACAGTGTCGAGAAGAGGTGCTCAAGAA
CTTCACAGACCAGCTGCGGAAGATTTCCAAGGATGCGGGGATGCCTATCCAGGGTCAACCTTGTTTCTGC
AAATATGCACAGGGGGCAGACAGCGTGGAGCCTATGTTCCGGCATCTCAAGAACACCTACTCAGGGCTGC
AGCTCATTATTGTCATCCTGCCAGGGAAGACGCCGGTGTATGCTGAGGTGAAACGTGTCGGAGATACACT
CTTGGGAATGGCTACGCAGTGTGTGCAGGTGAAGAACGTGGTCAAGACCTCACCTCAGACTCTGTCCAAC
CTCTGCCTCAAGATCAATGTCAAACTTGGTGGCATTAACAACATCCTAGTCCCACACCAGCGCTCTGCCG
TTTTTCAACAGCCAGTGATATTCCTGGGAGCAGATGTTACACACCCCCCAGCAGGGGATGGGAAAAAACC
TTCTATCACAGCAGTGGTAGGCAGTATGGATGCCCACCCCAGCCGATACTGTGCTACTGTGCGGGTACAG
CGACCACGGCAAGAGATCATTGAAGACTTGTCCTACATGGTGCGTGAGCTCCTCATCCAATTCTACAAGT
CCACCCGTTTCAAGCCTACCCGCATCATCTTCTACCGAGATGGGGTGCCTGAAGGCCAGCTACCCCAGAT
ACTCCACTATGAGCTACTGGCCATTCGTGATGCCTGCATCAAACTGGAAAAGGACTACCAGCCTGGGATC
ACTTATATTGTGGTGCAGAAACGCCATCACACCCGCCTTTTCTGTGCTGACAAGAATGAGCGAATTGGGA
AGAGTGGTAACATCCCAGCTGGGACCACAGTGGACACCAACATCACCCACCCATTTGAGTTTGACTTCTA
TCTGTGCAGCCACGCAGGCATCCAGGGCACCAGCCGACCATCCCATTACTATGTTCTTTGGGATGACAAC
CGTTTCACAGCAGATGAGCTCCAGATCCTGACGTACCAGCTGTGCCACACTTACGTACGATGCACACGCT
CTGTCTCTATCCCAGCACCTGCCTACTATGCCCGCCTGGTGGCTTTCCGGGCACGATACCACCTGGTGGA
CAAGGAGCATGACAGTGGAGAGGGGAGCCACATATCGGGGCAGAGCAATGGGCGGGACCCCCAGGCCCTG
GCCAAAGCCGTGCAGGTTCACCAGGATACTCTGCGCACCATGTACTTCGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209163 representing NM_012199
Red=Cloning site Green=Tags(s)

MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNR
EVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRM
LHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWK
MMLNIDVSATAFYKAQPVIEFMCEVLDIRNINEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVC
NVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRC
IKKLTDNQTSTMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGG
RNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAGMPIQGQPCFC
KYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSN
LCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVRVQ
RPRQEIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGI
TYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDN
RFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQAL
AKAVQVHQDTLRTMYFA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012199
ORF Size 2571 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012199.1, NM_012199.2, NM_012199.3, NM_012199.4, NP_036331
RefSeq Size 7478
RefSeq ORF 2574
Locus ID 26523
Cytogenetics 1p34.3
Protein Families Druggable Genome
MW 97 kDa
Gene Summary This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon. [provided by RefSeq, Nov 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations