CAF1(CHAF1A) (NM_005483) Human Tagged ORF Clone

CAT#: RC209138

CHAF1A (Myc-DDK-tagged)-Human chromatin assembly factor 1, subunit A (p150) (CHAF1A)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CAF1(CHAF1A) (NM_005483) Human Tagged ORF Clone
Symbol CHAF1A
Synonyms CAF-1; CAF1; CAF1B; CAF1P150; P150
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC209138 representing NM_005483
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGAGGAGCTGGAGTGCGGGGCGCCCGGCGCCAGGGGAGCCGCCACAGCCATGGATTGCAAAGATA
GACCAGCTTTTCCAGTTAAGAAGTTAATACAAGCCCGTCTGCCGTTTAAGCGCCTGAATCTTGTCCCAAA
GGGGAAAGCCGATGACATGTCAGACGATCAGGGTACTTCTGTGCAAAGTAAAAGCCCCGATTTAGAGGCC
TCTTTGGACACCTTGGAAAACAACTGTCATGTGGGTTCTGACATAGACTTTAGACCGAAACTTGTCAACG
GGAAGGGTCCCTTAGATAACTTTTTAAGAAATAGAATCGAAACCAGTATTGGCCAGAGCACAGTCATCAT
TGATTTGACAGAGGACTCGAATGAGCAGCCAGACAGTCTTGTGGACCACAATAAACTAAATTCTGAAGCC
TCTCCCTCCAGGGAGGCAATAAATGGCCAGCGAGAAGACACTGGGGATCAGCAGGGGTTGTTGAAGGCCA
TTCAGAACGACAAGTTGGCATTTCCTGGAGAGACCCTTTCAGACATTCCTTGCAAAACAGAGGAGGAGGG
TGTTGGCTGTGGAGGTGCAGGGAGGAGAGGCGACTCCCAGGAATGTTCGCCACGGAGCTGCCCGGAGCTG
ACGAGTGGCCCGAGAATGTGCCCCAGAAAGGAGCAGGACAGTTGGAGTGAAGCTGGGGGCATCCTGTTCA
AAGGGAAGGTGCCTATGGTGGTCTTGCAGGACATCTTGGCTGTGAGACCACCGCAAATCAAGTCCCTTCC
AGCCACACCCCAAGGCAAGAACATGACCCCTGAGAGTGAGGTGCTGGAATCTTTCCCCGAAGAAGACTCT
GTACTCAGCCATTCGTCCCTGAGCTCTCCCTCTTCCACCAGCTCGCCCGAGGGGCCGCCTGCTCCCCCAA
AGCAGCACAGCAGTACCAGTCCCTTCCCCACCTCCACGCCCCTCCGCAGAATAACTAAGAAATTCGTCAA
AGGCTCTACAGAGAAGAACAAGCTCAGACTGCAAAGAGATCAGGAGCGTCTGGGCAAGCAGCTCAAGTTA
CGTGCAGAAAGGGAAGAAAAGGAGAAGCTGAAAGAGGAGGCCAAGCGGGCCAAGGAGGAGGCCAAGAAGA
AGAAGGAGGAAGAGAAGGAGCTTAAGGAAAAGGAGAGGCGGGAGAAGCGGGAGAAGGATGAGAAGGAGAA
GGCGGAGAAGCAGCGGCTCAAGGAGGAGCGGCGCAAGGAGAGACAGGAAGCCCTGGAGGCTAAACTTGAG
GAAAAAAGGAAAAAGGAAGAAGAGAAACGGTTAAGAGAAGAAGAGAAGCGCATTAAAGCAGAGAAGGCCG
AAATCACGAGGTTCTTCCAGAAACCAAAGACTCCACAGGCCCCCAAGACCCTGGCCGGCTCCTGTGGGAA
GTTTGCCCCCTTTGAAATTAAAGAGCACATGGTCCTGGCCCCTCGGCGTCGGACCGCTTTCCATCCAGAC
CTCTGCAGTCAGCTGGACCAGCTCCTCCAGCAGCAGAGCGGCGAGTTCTCCTTCTTGAAAGACCTCAAAG
GCCGGCAGCCCCTGAGGTCCGGACCCACGCACGTTTCCACCCGGAATGCAGATATTTTTAACAGTGATGT
CGTCATCGTGGAGCGTGGGAAGGGCGACGGTGTTCCCGAGAGGAGGAAGTTTGGCAGGATGAAGCTCCTG
CAGTTCTGTGAGAACCACCGGCCTGCCTACTGGGGTACCTGGAATAAGAAGACGGCACTCATCCGCGCGC
GAGACCCCTGGGCCCAGGACACGAAGCTCCTGGACTATGAGGTGGACAGTGATGAGGAGTGGGAAGAAGA
GGAGCCTGGGGAGTCCCTGTCCCACAGTGAGGGGGATGATGATGACGACATGGGAGAGGATGAAGATGAG
GACGATGGTTTCTTTGTGCCCCATGGGTACCTGTCTGAGGACGAAGGTGTGACAGAGGAGTGTGCCGACC
CTGAGAACCATAAGGTCCGCCAGAAACTGAAGGCCAAGGAGTGGGACGAGTTCCTGGCTAAGGGGAAGCG
CTTTCGCGTCCTGCAACCTGTGAAGATCGGCTGCGTGTGGGCGGCTGACAGAGACTGCGCAGGCGATGAC
CTGAAGGTACTGCAGCAGTTCGCAGCCTGCTTCCTGGAGACCCTGCCGGCCCAGGAGGAGCAGACGCCCA
AGGCCTCCAAGCGGGAGAGGAGAGACGAGCAGATCCTGGCCCAGCTGCTGCCGCTCCTGCACGGCAATGT
GAACGGGAGCAAGGTCATCATCCGGGAGTTCCAGGAGCACTGCCGCCGGGGACTGCTCAGCAACCACACC
GGCAGCCCGCGGAGCCCCTCCACCACCTACCTGCACACCCCCACCCCCAGCGAGGATGCCGCCATCCCCT
CTAAGTCCCGGCTCAAGCGGCTCATTTCCGAGAACTCAGTGTATGAGAAGCGGCCTGACTTCAGGATGTG
CTGGTACGTGCACCCGCAGGTGCTACAGAGCTTCCAGCAGGAGCACCTGCCCGTGCCGTGCCAGTGGAGC
TATGTGACATCGGTGCCCTCGGCCCCCAAAGAGGACAGTGGCAGCGTCCCCTCCACGGGGCCCAGCCAGG
GCACTCCCATCTCGCTGAAGAGGAAGTCAGCGGGCAGCATGTGCATCACCCAATTCATGAAGAAGCGCAG
GCACGACGGCCAGATTGGTGCTGAAGACATGGACGGCTTCCAGGCAGACACGGAGGAGGAGGAAGAGGAG
GAGGGCGACTGTATGATCGTGGATGTCCCGGATGCTGCGGAGGTCCAAGCCCCGTGTGGAGCCGCTTCCG
GAGCTGGGGGTGGTGTGGGGGTGGACACCGGCAAGGCCACCCTGACCGCGAGCCCACTGGGTGCATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209138 representing NM_005483
Red=Cloning site Green=Tags(s)

MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEA
SLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLTEDSNEQPDSLVDHNKLNSEA
SPSREAINGQREDTGDQQGLLKAIQNDKLAFPGETLSDIPCKTEEEGVGCGGAGRRGDSQECSPRSCPEL
TSGPRMCPRKEQDSWSEAGGILFKGKVPMVVLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDS
VLSHSSLSSPSSTSSPEGPPAPPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKL
RAEREEKEKLKEEAKRAKEEAKKKKEEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLE
EKRKKEEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRRRTAFHPD
LCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIVERGKGDGVPERRKFGRMKLL
QFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDSDEEWEEEEPGESLSHSEGDDDDDMGEDEDE
DDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDD
LKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHT
GSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWS
YVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEE
EGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005483
ORF Size 2868 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005483.2, NP_005474
RefSeq Size 3344
RefSeq ORF 2871
Locus ID 10036
Cytogenetics 19p13.3
Protein Families Stem cell - Pluripotency, Transcription Factors
MW 106.7 kDa
Gene Summary Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM, Mar 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations