PASK (NM_015148) Human Tagged ORF Clone

CAT#: RC209096

Reviews ()
Write a review

PASK (Myc-DDK-tagged)-Human PAS domain containing serine/threonine kinase (PASK)



  "NM_015148" in other vectors (6)

Reconstitution Protocol

USD 1,152.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PASK"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PASK
Synonyms PASKIN; STK37
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209096 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGACGGGGGCTTAACAGCCTTTGAAGAGGACCAGAGATGCCTTTCCCAGAGCCTCCCCTTGCCAG
TGTCAGCAGAGGGCCCAGCTGCACAGACCACTGCTGAGCCCAGCAGGTCGTTTTCCTCAGCCCACAGACA
CCTGAGCAGAAGGAATGGGCTTTCCAGACTCTGCCAGAGCAGGACAGCGCTCTCTGAAGACAGATGGAGC
TCCTATTGTCTATCATCACTGGCTGCCCAGAATATTTGTACAAGTAAACTGCACTGCCCTGCTGCCCCTG
AGCACACGGACCCGTCCGAACCGCGGGGCAGTGTGTCCTGCTGCTCCCTGCTGCGGGGACTGTCCTCAGG
GTGGTCCTCACCTCTGCTTCCGGCCCCTGTGTGCAACCCTAACAAGGCCATCTTCACGGTGGATGCCAAG
ACCACAGAGATCCTGGTTGCTAACGACAAAGCTTGCGGGCTCCTGGGGTACAGCAGCCAGGACCTGATTG
GCCAGAAGCTCACGCAGTTCTTTCTGAGGTCAGATTCTGATGTGGTGGAGGCCCTCAGCGAGGAGCACAT
GGAGGCCGACGGCCACGCTGCGGTGGTGTTTGGCACGGTGGTGGACATCATCAGCCGTAGTGGGGAGAAG
ATTCCAGTGTCTGTGTGGATGAAGAGGATGCGGCAGGAGCGCCGCCTATGCTGCGTGGTGGTCCTGGAGC
CCGTGGAGAGGGTCTCGACCTGGGTCGCTTTCCAGAGCGATGGCACCGTCACGTCATGTGACAGTCTCTT
TGCTCATCTTCACGGGTACGTGTCTGGGGAGGACGTGGCTGGGCAGCATATCACAGACCTGATCCCTTCT
GTGCAGCTCCCTCCTTCTGGCCAGCACATCCCAAAGAATCTCAAGATTCAGAGGTCTGTTGGAAGAGCCA
GGGACGGTACCACCTTCCCTCTGAGCTTAAAGCTGAAATCCCAACCCAGCAGCGAGGAGGCGACCACCGG
TGAGGCGGCCCCTGTGAGCGGCTACCGGGCATCTGTCTGGGTGTTCTGCACCATCAGTGGCCTCATCACC
CTCCTGCCGGATGGGACCATCCACGGCATCAACCACAGCTTCGCGCTGACACTGTTTGGTTACGGAAAGA
CGGAGCTCCTGGGCAAGAATATCACTTTCCTGATTCCTGGTTTCTACAGCTACATGGACCTTGCGTACAA
CAGCTCATTACAGCTCCCAGACCTGGCCAGCTGCCTGGACGTCGGCAATGAGAGTGGGTGTGGGGAGAGA
ACCTTGGACCCGTGGCAGGGCCAGGACCCAGCTGAGGGGGGCCAGGATCCAAGGATTAATGTCGTGCTTG
CTGGTGGCCACGTTGTGCCCCGAGATGAGATCCGGAAGCTGATGGAAAGCCAAGACATCTTCACCGGGAC
TCAGACTGAGCTGATTGCTGGAGGCCAGCTCCTTTCCTGCCTCTCACCTCAGCCTGCTCCAGGGGTGGAC
AATGTCCCAGAAGGAAGCCTGCCAGTGCACGGTGAACAGGCGCTGCCCAAGGACCAGCAAATCACTGCCT
TGGGGAGAGAGGAACCTGTGGCAATAGAGAGCCCCGGACAGGATCTTCTGGGAGAAAGCAGGTCTGAACC
AGTGGATGTGAAGCCATTTGCTTCCTGCGAAGATTCTGAAGCTCCAGTCCCAGCTGAGGATGGGGGCAGT
GATGCTGGCATGTGTGGCCTGTGTCAGAAGGCCCAGCTAGAGCGGATGGGAGTCAGTGGTCCCAGCGGTT
CAGACCTTTGGGCTGGGGCTGCCGTGGCCAAGCCCCAGGCCAAGGGTCAGCTGGCGGGGGGCAGCCTCCT
GATGCACTGCCCTTGCTATGGGAGTGAATGGGGCTTGTGGTGGCGAAGCCAGGACTTGGCCCCCAGCCCC
TCTGGGATGGCAGGCCTCTCGTTTGGGACACCTACTCTAGATGAGCCGTGGCTGGGAGTGGAAAACGACC
GAGAAGAGCTGCAGACCTGCTTGATTAAGGAGCAGCTGTCCCAGTTGAGCCTTGCAGGAGCCCTGGATGT
CCCCCACGCCGAACTCGTTCCGACAGAGTGCCAGGCTGTCACCGCTCCTGTGTCGTCCTGCGATCTGGGA
GGCAGAGACCTGTGCGGTGGCTGCACGGGCAGCTCCTCAGCCTGCTATGCCTTGGCCACGGACCTCCCTG
GGGGCCTGGAAGCAGTGGAGGCCCAGGAGGTTGATGTGAATTCGTTTTCCTGGAACCTCAAGGAACTCTT
TTTCAGTGACCAGACAGACCAAACGTCATCAAATTGTTCCTGTGCTACGTCTGAACTCAGAGAGACACCC
TCTTCCTTGGCAGTGGGCTCCGATCCAGATGTAGGCAGTCTCCAGGAACAGGGGTCGTGTGTCCTGGATG
ACAGGGAGCTGTTACTACTGACCGGCACCTGTGTTGACCTTGGCCAAGGCCGACGGTTCCGGGAGAGCTG
TGTGGGACATGATCCAACAGAACCGCTTGAGGTTTGTTTGGTGTCCTCTGAGCATTATGCAGCAAGCGAC
AGAGAAAGCCCAGGACACGTTCCTTCCACGTTGGATGCTGGCCCTGAGGACACGTGCCCATCAGCAGAGG
AGCCAAGGCTGAACGTCCAGGTCACCTCCACGCCCGTGATCGTGATGCGCGGGGCTGCTGGCCTGCAGCG
GGAGATCCAGGAGGGTGCCTACTCCGGGAGCTGCTACCATCGAGATGGCTTACGGCTGAGTATACAGTTT
GAGGTGAGGCGGGTGGAGCTCCAGGGCCCCACACCTCTGTTCTGCTGCTGGCTGGTGAAAGACCTCCTCC
ACAGCCAACGCGACTCAGCCGCCAGGACCCGCCTGTTCCTTGCCAGCCTGCCCGGCTCCACCCACTCTAC
CGCTGCTGAGCTCACCGGACCCAGCCTGGTGGAAGTGCTCAGAGCCAGACCCTGGTTTGAGGAGCCCCCC
AAGGCTGTGGAACTGGAGGGGTTGGCGGCCTGTGAGGGCGAGTACTCCCAAAAGTACAGTACCATGAGCC
CGCTGGGCAGTGGGGCCTTCGGCTTCGTGTGGACTGCTGTGGACAAGGAAAAAAACAAGGAGGTGGTGGT
GAAGTTTATTAAGAAGGAGAAGGTCTTGGAGGATTGTTGGATTGAGGATCCCAAACTTGGGAAAGTTACT
TTAGAGATCGCAATTCTATCCAGGGTGGAGCACGCCAATATCATCAAGGTATTGGATATATTTGAAAACC
AAGGGTTCTTCCAGCTTGTGATGGAGAAGCACGGCTCCGGCCTAGACCTCTTCGCTTTCATCGACCGCCA
CCCCAGGCTGGATGAGCCCCTGGCGAGCTACATCTTCCGACAACTAGTGTCAGCAGTGGGATACCTGCGC
TTGAAGGACATCATCCACCGTGACATCAAGGATGAGAACATCGTGATCGCCGAGGACTTCACAATCAAGC
TGATAGACTTTGGCTCGGCCGCCTACTTGGAAAGGGGAAAATTATTTTATACTTTTTGTGGGACCATCGA
GTACTGTGCACCGGAAGTTCTCATGGGGAATCCCTACAGAGGGCCGGAGCTGGAGATGTGGTCTCTGGGA
GTCACTCTGTACACGCTGGTCTTTGAGGAGAACCCCTTCTGTGAGCTGGAGGAGACCGTGGAGGCTGCCA
TACACCCGCCATACCTGGTGTCCAAAGAACTCATGAGCCTTGTGTCTGGGCTGCTGCAGCCAGTCCCTGA
GAGACGCACCACCTTGGAGAAGCTGGTGACAGACCCGTGGGTAACACAGCCTGTGAATCTTGCTGACTAT
ACATGGGAAGAGGTGTTTCGAGTAAACAAGCCAGAAAGTGGAGTTCTGTCCGCTGCGAGCCTGGAGATGG
GGAACAGGAGCCTGAGTGATGTGGCCCAGGCTCAGGAGCTTTGTGGGGGCCCCGTTCCAGGCGAGGCTCC
TAATGGCCAAGGCTGTTTGCATCCCGGGGATCCCCGTCTGCTGACCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209096 protein sequence
Red=Cloning site Green=Tags(s)

MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQSRTALSEDRWS
SYCLSSLAAQNICTSKLHCPAAPEHTDPSEPRGSVSCCSLLRGLSSGWSSPLLPAPVCNPNKAIFTVDAK
TTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDIISRSGEK
IPVSVWMKRMRQERRLCCVVVLEPVERVSTWVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPS
VQLPPSGQHIPKNLKIQRSVGRARDGTTFPLSLKLKSQPSSEEATTGEAAPVSGYRASVWVFCTISGLIT
LLPDGTIHGINHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSLQLPDLASCLDVGNESGCGER
TLDPWQGQDPAEGGQDPRINVVLAGGHVVPRDEIRKLMESQDIFTGTQTELIAGGQLLSCLSPQPAPGVD
NVPEGSLPVHGEQALPKDQQITALGREEPVAIESPGQDLLGESRSEPVDVKPFASCEDSEAPVPAEDGGS
DAGMCGLCQKAQLERMGVSGPSGSDLWAGAAVAKPQAKGQLAGGSLLMHCPCYGSEWGLWWRSQDLAPSP
SGMAGLSFGTPTLDEPWLGVENDREELQTCLIKEQLSQLSLAGALDVPHAELVPTECQAVTAPVSSCDLG
GRDLCGGCTGSSSACYALATDLPGGLEAVEAQEVDVNSFSWNLKELFFSDQTDQTSSNCSCATSELRETP
SSLAVGSDPDVGSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRESCVGHDPTEPLEVCLVSSEHYAASD
RESPGHVPSTLDAGPEDTCPSAEEPRLNVQVTSTPVIVMRGAAGLQREIQEGAYSGSCYHRDGLRLSIQF
EVRRVELQGPTPLFCCWLVKDLLHSQRDSAARTRLFLASLPGSTHSTAAELTGPSLVEVLRARPWFEEPP
KAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVT
LEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLR
LKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLG
VTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADY
TWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRLLTS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015148
ORF Size 3969 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015148.4
RefSeq Size 4588 bp
RefSeq ORF 3972 bp
Locus ID 23178
UniProt ID Q96RG2
Cytogenetics 2q37.3
Domains S_TKc
Protein Families Druggable Genome, Protein Kinase, Stem cell - Pluripotency
MW 142.9 kDa
Gene Summary This gene encodes a member of the serine/threonine kinase family that contains two PAS domains. Expression of this gene is regulated by glucose, and the encoded protein plays a role in the regulation of insulin gene expression. Downregulation of this gene may play a role in type 2 diabetes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.