SEC23IP (NM_007190) Human Tagged ORF Clone

CAT#: RC209056

Reviews ()
Write a review

SEC23IP (Myc-DDK-tagged)-Human SEC23 interacting protein (SEC23IP), transcript variant 1



  "NM_007190" in other vectors (5)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 915.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "SEC23IP"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SEC23IP
Synonyms iPLA1beta; MSTP053; P125; P125A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209056 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAGAGAAAACCTAACGGTGGCAGCGGCGGCGCCTCCACTTCCTCATCGGGCACTAACTTACTTT
TCTCCTCCTCGGCCACGGAGTTCAGCTTCAATGTGCCCTTCATCCCAGTCACCCAGGCCTCCGCTTCTCC
GGCCTCCCTGCTCTTACCGGGAGAGGATTCCACAGATGTTGGTGAGGAGGACAGCTTCCTTGGTCAGACT
TCTATTCACACATCTGCCCCACAGACATTTAGTTACTTCTCTCAGGTATCAAGCAGCAGTGATCCTTTTG
GGAATATTGGACAGTCACCATTAACAACTGCAGCAACCTCAGTTGGACAATCAGGATTCCCCAAGCCCCT
GACTGCTCTCCCTTTTACAACTGGATCCCAAGATGTCTCGAATGCATTTTCACCATCCATTTCGAAGGCT
CAACCTGGTGCTCCACCTTCCTCACTGATGGGAATAAATTCTTATCTGCCTTCTCAGCCAAGTAGTCTCC
CTCCTTCATATTTTGGGAACCAACCCCAAGGAATTCCCCAACCAGGATACAATCCATATCGCCATACCCC
TGGCAGCAGCAGGGCTAATCCTTACATTGCACCACCCCAGCTGCAGCAGTGCCAAACACCAGGCCCTCCT
GCTCATCCTCCACCTTCTGGACCCCCTGTTCAGATGTACCAGATGCCTCCAGGATCTTTGCCACCGGTTC
CTTCTTCAGTGCAGTCACCGGCACAGCAGCAGGTACCTGCCAGACCTGGGGCTCCCTCTGTTCAAGTGCC
ATCTCCTTTTCTACTTCAAAACCAATATGAGCCTGTTCAGCCCCACTGGTTTTACTGCAAGGAGGTAGAA
TACAAACAACTGTGGATGCCTTTTAGTGTGTTCGACTCTTTGAATCTTGAAGAAATCTATAATTCAGTTC
AGCCAGATCCGGAGAGCGTGGTTCTTGGCACGGATGGAGGGCGCTACGATGTTTACCTCTATGACCGAAT
AAGGAAGGCTGCCTACTGGGAAGAGGAGCCAGCCGAAGTGAGACGCTGTACTTGGTTTTACAAGGGGGAC
ACAGATAGTCGATTTATTCCCTATACTGAGGAGTTCAGTGAAAAACTAGAGGCTGAATATAAAAAAGCTG
TAACCACTAATCAGTGGCACCGAAGATTAGAGTTTCCAAGTGGAGAGACAATTGTTATGCACAATCCAAA
GGTTATTGTTCAGTTCCAGCCCTCCTCAGTGCCAGATGAATGGGGCACCACGCAAGATGGACAGACAAGG
CCCAGGGTTGTAAAGCGTGGAATTGATGATAACCTTGATGAAATTCCCGACGGGGAGATGCCTCAAGTTG
ACCATTTGGTGTTTGTGGTGCATGGCATTGGACCTGTGTGTGACTTACGCTTTAGGAGCATTATTGAGTG
TGTGGATGATTTTAGGGTGGTTTCTCTCAAATTGCTGCGGACACATTTCAAGAAATCTTTAGATGACGGG
AAAGTAAGCAGAGTGGAGTTCCTTCCAGTTCATTGGCATAGTTCTTTGGGTGGGGACGCCACAGGTGTGG
ACAGGAATATTAAGAAAATCACTTTGCCAAGTATTGGTCGATTTCGTCACTTTACCAATGAAACTTTGCT
AGATATTTTATTTTATAACAGCCCCACCTACTGTCAGACAATTGTGGAAAAAGTAGGAATGGAGATAAAC
CATCTGCATGCACTCTTTATGAGTCGGAACCCAGACTTCAAAGGAGGTGTCTCTGTTGCTGGTCACAGTT
TAGGTTCTTTAATATTGTTTGACATCCTGTCTAATCAAAAAGATTTGAATTTATCAAAGTGCCCTGGACC
TCTTGCTGTTGCTAATGGAGTTGTGAAGCAGCTACATTTTCAGGAAAAGCAGATGCCTGAAGAGCCAAAG
CTGACTTTGGATGAGTCGTATGACCTTGTTGTTGAAAATAAAGAAGTCCTAACTTTGCAAGAAACTCTGG
AAGCACTTAGCCTCTCTGAATATTTTAGCACTTTTGAAAAGGAAAAGATTGATATGGAGTCCCTGCTTAT
GTGTACAGTTGATGACCTGAAGGAAATGGGGATACCCCTTGGACCCAGAAAGAAGATAGCTAACTTTGTA
GAACATAAAGCAGCCAAACTGAAAAAAGCAGCGTCAGAAAAGAAGGCAGTGGCGGCCACTTCTACAAAAG
GACAAGAGCAAAGTGCCCAGAAGACTAAAGACATGGCTTCCCTCCCCTCAGAATCCAATGAGCCAAAGAG
GAAACTTCCAGTTGGTGCTTGCGTGTCTTCTGTGTGTGTGAATTATGAATCTTTTGAAGTTGGCGCCGGA
CAGGTTTCTGTTGCTTACAACTCATTAGATTTTGAACCAGAGATATTCTTTGCCTTGGGGTCTCCAATTG
CTATGTTTCTCACTATTCGAGGAGTTGATAGGATAGATGAGAATTACAGCCTTCCTACCTGTAAAGGGTT
CTTCAATATTTATCATCCGCTTGATCCAGTGGCATATAGATTAGAACCTATGATTGTTCCAGATTTGGAC
CTAAAAGCTGTTCTCATTCCACATCACAAAGGCAGAAAAAGACTTCATTTAGAATTGAAAGAGAGTCTCT
CTCGTATGGGATCTGATTTGAAGCAGGGTTTTATTAGCTCTCTCAAAAGTGCTTGGCAGACATTAAATGA
GTTTGCCCGTGCTCATACGTCTTCAACCCAGTTGCAAGAAGAATTGGAGAAGGTGGCCAATCAGATCAAA
GAAGAAGAAGAAAAGCAAGTAGTTGAAGCAGAAAAGGTTGTTGAAAGTCCAGATTTTTCCAAGGATGAGG
ACTACTTAGGAAAGGTTGGAATGTTAAATGGAGGCCGCCGAATTGACTACGTTCTCCAAGAAAAACCAAT
AGAGAGTTTTAATGAATACCTTTTCGCTCTTCAGAGTCACTTATGCTATTGGGAATCTGAAGATACTGCT
CTGTTACTACTTAAAGAAATTTATCGAACAATGAACATTAGTCCAGAACAGCCCCAGCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209056 protein sequence
Red=Cloning site Green=Tags(s)

MAERKPNGGSGGASTSSSGTNLLFSSSATEFSFNVPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQT
SIHTSAPQTFSYFSQVSSSSDPFGNIGQSPLTTAATSVGQSGFPKPLTALPFTTGSQDVSNAFSPSISKA
QPGAPPSSLMGINSYLPSQPSSLPPSYFGNQPQGIPQPGYNPYRHTPGSSRANPYIAPPQLQQCQTPGPP
AHPPPSGPPVQMYQMPPGSLPPVPSSVQSPAQQQVPARPGAPSVQVPSPFLLQNQYEPVQPHWFYCKEVE
YKQLWMPFSVFDSLNLEEIYNSVQPDPESVVLGTDGGRYDVYLYDRIRKAAYWEEEPAEVRRCTWFYKGD
TDSRFIPYTEEFSEKLEAEYKKAVTTNQWHRRLEFPSGETIVMHNPKVIVQFQPSSVPDEWGTTQDGQTR
PRVVKRGIDDNLDEIPDGEMPQVDHLVFVVHGIGPVCDLRFRSIIECVDDFRVVSLKLLRTHFKKSLDDG
KVSRVEFLPVHWHSSLGGDATGVDRNIKKITLPSIGRFRHFTNETLLDILFYNSPTYCQTIVEKVGMEIN
HLHALFMSRNPDFKGGVSVAGHSLGSLILFDILSNQKDLNLSKCPGPLAVANGVVKQLHFQEKQMPEEPK
LTLDESYDLVVENKEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFV
EHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAG
QVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLD
LKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIK
EEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTA
LLLLKEIYRTMNISPEQPQH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007190
ORF Size 3000 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007190.4
RefSeq Size 7306 bp
RefSeq ORF 3003 bp
Locus ID 11196
UniProt ID Q9Y6Y8
Cytogenetics 10q26.11-q26.12
Domains SAM, DDHD
MW 111.1 kDa
Gene Summary This gene encodes a member of the phosphatidic acid preferring-phospholipase A1 family. The encoded protein is localized to endoplasmic reticulum exit sites and plays a critical role in ER-Golgi transport as part of the multimeric coat protein II complex. An orthologous gene in frogs is required for normal neural crest cell development, suggesting that this gene may play a role in Waardenburg syndrome neural crest defects. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Feb 2011]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.