LAP3 (NM_015907) Human Tagged ORF Clone

CAT#: RC209052

LAP3 (Myc-DDK-tagged)-Human leucine aminopeptidase 3 (LAP3)

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name LAP3 (NM_015907) Human Tagged ORF Clone
Symbol LAP3
Synonyms HEL-S-106; LAP; LAPEP; PEPS
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC209052 representing NM_015907
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCTTGCTGCCTCTTCCGGCTGCGGGGCGAGTAGTCGTCCGACGTCTGGCCGTGAGACGTTTCGGGA
GCCGGAGTCTCTCCACCGCAGACATGACGAAGGGCCTTGTTTTAGGAATCTATTCCAAAGAAAAAGAAGA
TGATGTGCCACAGTTCACAAGTGCAGGAGAGAATTTTGATAAATTGTTAGCTGGAAAGCTGAGAGAGACT
TTGAACATATCTGGACCACCTCTGAAGGCAGGGAAGACTCGAACCTTTTATGGTCTGCATCAGGACTTCC
CCAGCGTGGTGCTAGTTGGCCTCGGCAAAAAGGCAGCTGGAATCGACGAACAGGAAAACTGGCATGAAGG
CAAAGAAAACATCAGAGCTGCTGTTGCAGCGGGGTGCAGGCAGATTCAAGACCTGGAGCTCTCGTCTGTG
GAGGTGGATCCCTGTGGAGACGCTCAGGCTGCTGCGGAGGGAGCGGTGCTTGGTCTCTATGAATACGATG
ACCTAAAGCAAAAAAAGAAGATGGCTGTGTCGGCAAAGCTCTATGGAAGTGGGGATCAGGAGGCCTGGCA
GAAAGGAGTCCTGTTTGCTTCTGGGCAGAACTTGGCACGCCAATTGATGGAGACGCCAGCCAATGAGATG
ACGCCAACCAGATTTGCCGAAATTATTGAGAAGAATCTCAAAAGTGCTAGTAGTAAAACCGAGGTCCATA
TCAGACCCAAGTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAAGGATCTGACGA
GCCCCCAGTCTTCTTGGAAATTCACTACAAAGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTT
GGGAAAGGAATTACCTTTGACAGTGGTGGTATCTCCATCAAGGCTTCTGCAAATATGGACCTCATGAGGG
CTGACATGGGAGGAGCTGCAACTATATGCTCAGCCATCGTGTCTGCTGCAAAGCTTAATTTGCCCATTAA
TATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCCAACAAGCCGGGGGATGTTGTT
AGAGCCAAAAACGGGAAGACCATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATG
CGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGA
TGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAG
GCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAG
ATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATT
CCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGAT
GAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTT
TCAGTCAAGACAATGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209052 representing NM_015907
Red=Cloning site Green=Tags(s)

MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRET
LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSV
EVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEM
TPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV
GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV
RAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKD
EVPYLRKGMTGRPTRTLIEFLLRFSQDNA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015907
ORF Size 1557 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015907.1, NM_015907.2, NP_056991
RefSeq Size 2100
Locus ID 51056
Cytogenetics 4p15.32
Domains Peptidase_M17
Protein Families Protease, Druggable Genome
Protein Pathways Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways
MW 56 kDa
Gene Summary Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.