ABCB10 (NM_012089) Human Tagged ORF Clone

CAT#: RC209046

Reviews ()
Write a review

ABCB10 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 10 (ABCB10), nuclear gene encoding mitochondrial protein



  "NM_012089" in other vectors (7)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ABCB10 (NM_012089) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ABCB10
Synonyms EST20237; M-ABC2; MTABC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC209046 representing NM_012089
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGAGGCCCCCCTGCCTGGCCGCTGCGGCTGCTCGAGCCACCGAGCCCTGCCGAGCCAGGTCGGCTCC
TGCCGGTAGCCTGCGTGTGGGCCGCGGCCAGCCGCGTTCCCGGGTCCCTATCGCCGTTCACTGGCCTGAG
GCCGGCGCGGCTATGGGGCGCGGGGCCCGCGCTGCTCTGGGGCGTTGGAGCCGCGCGCCGCTGGAGGAGC
GGCTGCCGGGGCGGGGGTCCGGGCGCCTCGCGGGGCGTCCTGGGCCTCGCGCGGCTCCTGGGGCTGTGGG
CTCGCGGCCCCGGCAGCTGCAGGTGCGGGGCTTTTGCCGGGCCAGGCGCTCCTCGGCTCCCGCGCGCCCG
GTTCCCGGGCGGTCCCGCAGCCGCTGCCTGGGCAGGGGACGAGGCCTGGCGGCGCGGGCCGGCGGCGCCT
CCCGGGGACAAGGGGCGGCTGCGCCCCGCAGCGGCCGGACTCCCGGAGGCCCGGAAGCTCCTGGGGCTGG
CGTACCCTGAGCGCCGGAGGCTGGCAGCTGCGGTTGGATTTCTCACGATGTCCAGTGTTATCTCCATGTC
TGCCCCTTTCTTCCTGGGGAAGATCATTGATGTCATCTATACCAACCCCACTGTGGACTACAGCGACAAC
CTGACCCGCCTCTGCCTAGGGCTCAGTGCCGTGTTTCTGTGTGGTGCTGCCGCCAATGCCATTCGTGTCT
ACCTCATGCAAACTTCAGGTCAGCGCATTGTGAATAGGCTGAGAACTTCATTATTCTCCTCCATTCTGAG
GCAGGAGGTTGCTTTCTTTGACAAGACTCGCACAGGAGAATTGATTAACCGCCTCTCATCAGACACTGCA
CTCCTGGGGCGCTCAGTGACTGAAAACCTCTCAGATGGGCTCAGGGCCGGGGCCCAGGCTTCTGTAGGCA
TCAGTATGATGTTTTTTGTCTCACCTAATCTGGCCACCTTTGTTTTGAGCGTGGTGCCTCCAGTGTCAAT
CATTGCTGTAATTTATGGGCGATATCTACGGAAACTGACCAAAGTCACTCAGGATTCCCTGGCACAAGCC
ACTCAGCTAGCTGAGGAACGTATTGGAAATGTAAGAACTGTTCGAGCTTTTGGGAAAGAAATGACTGAAA
TCGAGAAATATGCCAGCAAAGTGGACCATGTAATGCAGTTAGCAAGGAAAGAGGCATTCGCCCGGGCTGG
TTTCTTTGGAGCAACTGGGCTCTCCGGAAACCTGATCGTGCTTTCTGTCCTGTACAAAGGAGGGCTGCTG
ATGGGCAGTGCCCACATGACCGTGGGTGAACTCTCTTCCTTCCTAATGTATGCTTTCTGGGTTGGAATAA
GCATTGGAGGTCTGAGCTCTTTCTACTCGGAGCTGATGAAAGGACTGGGTGCAGGGGGGCGCCTCTGGGA
GCTCCTGGAGAGAGAGCCCAAGCTGCCTTTTAACGAGGGGGTCATCTTAAATGAGAAAAGCTTCCAGGGT
GCTTTGGAGTTTAAGAACGTGCATTTTGCCTATCCAGCTCGCCCAGAGGTGCCCATATTTCAGGATTTCA
GCCTTTCCATTCCGTCAGGATCTGTCACGGCACTGGTTGGCCCAAGTGGTTCTGGCAAATCAACAGTGCT
TTCACTCCTGCTGAGGTTGTACGACCCTGCTTCTGGAACTATTAGTCTTGATGGCCATGACATCCGTCAG
CTAAACCCAGTGTGGCTGAGATCCAAAATTGGGACAGTGAGTCAGGAACCCATTTTGTTTTCTTGCTCTA
TTGCTGAGAACATTGCTTATGGTGCTGATGACCCTTCCTCTGTGACCGCTGAGGAAATCCAGAGAGTGGC
TGAAGTGGCCAATGCAGTGGCCTTCATCCGGAATTTCCCCCAAGGGTTCAACACTGTGGTTGGAGAAAAG
GGTGTTCTCCTCTCAGGTGGGCAGAAACAGCGGATTGCGATTGCCCGTGCTCTGCTAAAGAATCCCAAAA
TTCTTCTCCTAGATGAAGCAACCAGTGCGCTGGATGCCGAAAATGAGTACCTTGTTCAAGAAGCTCTAGA
TCGACTGATGGATGGAAGAACGGTGTTAGTTATTGCCCATCGTCTGTCCACCATTAAGAATGCTAATATG
GTTGCTGTTCTTGACCAAGGAAAAATTACTGAATATGGAAAACATGAAGAGCTGCTTTCAAAACCAAATG
GGATATACAGAAAACTAATGAACAAACAAAGTTTTATTTCAGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209046 representing NM_012089
Red=Cloning site Green=Tags(s)

MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLWGVGAARRWRS
GCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPGGPAAAAWAGDEAWRRGPAAP
PGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDN
LTRLCLGLSAVFLCGAAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTA
LLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQA
TQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEGVILNEKSFQG
ALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQ
LNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEK
GVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANM
VAVLDQGKITEYGKHEELLSKPNGIYRKLMNKQSFISA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012089
ORF Size 2214 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012089.1, NM_012089.2, NP_036221.1
RefSeq Size 3857 bp
RefSeq ORF 2217 bp
Locus ID 23456
Cytogenetics 1q42.13
Domains ABC_membrane, ABC_tran, AAA
Protein Families Druggable Genome, Transmembrane
Protein Pathways ABC transporters
MW 79 kDa
Gene Summary The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ABCB10"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit polyclonal anti-ABCB10 antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools