Cytochrome P450 17A1 (CYP17A1) (NM_000102) Human Tagged ORF Clone

CAT#: RC209042

Reviews ()
Write a review

CYP17A1 (Myc-DDK-tagged)-Human cytochrome P450, family 17, subfamily A, polypeptide 1 (CYP17A1)



  "NM_000102" in other vectors (6)

Reconstitution Protocol

USD 709.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "CYP17A1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CYP17A1
Synonyms CPT7; CYP17; P450C17; S17AH
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209042 representing NM_000102
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGAGCTCGTGGCTCTCTTGCTGCTTACCCTAGCTTATTTGTTTTGGCCCAAGAGAAGGTGCCCTG
GTGCCAAGTACCCCAAGAGCCTCCTGTCCCTGCCCCTGGTGGGCAGCCTGCCATTCCTCCCCAGACATGG
CCATATGCATAACAACTTCTTCAAGCTGCAGAAAAAATATGGCCCCATCTATTCTGTTCGTATGGGCACC
AAGACTACAGTGATTGTCGGCCACCACCAGCTGGCCAAGGAGGTGCTTATTAAGAAGGGCAAGGACTTCT
CTGGGCGGCCTCAAATGGCAACTCTAGACATCGCGTCCAACAACCGTAAGGGTATCGCCTTCGCTGACTC
TGGCGCACACTGGCAGCTGCATCGAAGGCTGGCGATGGCCACCTTTGCCCTGTTCAAGGATGGCGATCAG
AAGCTGGAGAAGATCATTTGTCAGGAAATCAGTACATTGTGTGATATGCTGGCCACCCACAACGGACAGT
CCATAGACATCTCCTTTCCTGTCTTCGTGGCGGTAACCAATGTCATCTCCTTGATCTGCTTCAATACCTC
CTACAAGAATGGGGACCCTGAGTTGAATGTCATACAGAATTACAATGAAGGCATCATAGACAACCTGAGC
AAAGACAGCCTGGTGGACCTAGTCCCCTGGTTGAAGATTTTCCCCAACAAAACCCTGGAAAAATTAAAGA
GCCATGTTAAAATACGAAATGATCTGCTGAATAAAATACTTGAAAATTACAAGGAGAAATTCCGGAGTGA
CTCTATCACCAACATGCTGGACACACTGATGCAAGCCAAGATGAACTCAGATAATGGCAATGCTGGCCCA
GATCAAGACTCAGAGCTGCTTTCAGATAACCACATTCTCACCACCATAGGGGACATCTTTGGGGCTGGCG
TGGAGACCACCACCTCTGTGGTTAAATGGACCCTGGCCTTCCTGCTGCACAATCCTCAGGTGAAGAAGAA
GCTCTACGAGGAGATTGACCAGAATGTGGGTTTCAGCCGCACACCAACTATCAGTGACCGTAACCGTCTC
CTCCTGCTGGAGGCCACCATCCGAGAGGTGCTTCGCCTCAGGCCCGTGGCCCCTATGCTCATCCCCCACA
AGGCCAACGTTGACTCCAGCATCGGTGAGTTTGCTGTGGACAAGGGCACAGAAGTTATCATCAATCTGTG
GGCGCTGCATCACAATGAGAAGGAGTGGCACCAGCCGGATCAGTTCATGCCTGAGCGTTTCTTGAATCCA
GCGGGGACCCAGCTCATCTCACCGTCAGTAAGCTATTTGCCCTTCGGAGCAGGACCTCGCTCCTGTATAG
GTGAGATCCTGGCCCGCCAGGAGCTCTTCCTCATCATGGCCTGGCTGCTGCAGAGGTTCGACCTGGAAGT
GCCAGATGATGGGCAGCTGCCCTCCCTGGAAGGCATCCCCAAGGTGGTCTTTCTGATCGACTCTTTCAAA
GTGAAGATCAAGGTGCGCCAGGCCTGGAGGGAAGCCCAGGCTGAGGGTAGCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209042 representing NM_000102
Red=Cloning site Green=Tags(s)

MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGT
KTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQ
KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLS
KDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGP
DQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRL
LLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFK
VKIKVRQAWREAQAEGST

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000102
ORF Size 1524 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000102.4
RefSeq Size 1755 bp
RefSeq ORF 1527 bp
Locus ID 1586
UniProt ID P05093
Cytogenetics 10q24.32
Domains p450
Protein Families Druggable Genome, P450
Protein Pathways C21-Steroid hormone metabolism, Metabolic pathways
MW 57.2 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia. [provided by RefSeq, Jul 2008]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.