CD13(ANPEP) (NM_001150) Human Tagged ORF Clone

CAT#: RC208950

ANPEP (Myc-DDK-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CD13(ANPEP) (NM_001150) Human Tagged ORF Clone
Symbol ANPEP
Synonyms APN; CD13; GP150; LAP1; P150; PEPN
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208950 representing NM_001150
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGGGCTTCTATATTTCCAAGTCCCTGGGCATCCTGGGGATCCTCCTGGGCGTGGCAGCCGTGT
GCACAATCATCGCACTGTCAGTGGTGTACTCCCAGGAGAAGAACAAGAACGCCAACAGCTCCCCCGTGGC
CTCCACCACCCCGTCCGCCTCAGCCACCACCAACCCCGCCTCGGCCACCACCTTGGACCAAAGTAAAGCG
TGGAATCGTTACCGCCTCCCCAACACGCTGAAACCCGATTCCTACCAGGTGACGCTGAGACCGTACCTCA
CCCCCAATGACAGGGGCCTGTACGTTTTTAAGGGCTCCAGCACCGTCCGTTTCACCTGCAAGGAGGCCAC
TGACGTCATCATCATCCACAGCAAGAAGCTCAACTACACCCTCAGCCAGGGGCACAGGGTGGTCCTGCGT
GGTGTGGGAGGCTCCCAGCCCCCCGACATTGACAAGACTGAGCTGGTGGAGCCCACCGAGTACCTGGTGG
TGCACCTCAAGGGCTCCCTGGTGAAGGACAGCCAGTATGAGATGGACAGCGAGTTCGAGGGGGAGTTGGC
AGATGACCTGGCGGGCTTCTACCGCAGCGAGTACATGGAGGGCAATGTCAGAAAGGTGGTGGCCACTACA
CAGATGCAGGCTGCAGATGCCCGGAAGTCCTTCCCATGCTTCGATGAGCCGGCCATGAAGGCCGAGTTCA
ACATCACGCTTATCCACCCCAAGGACCTGACAGCCCTGTCCAACATGCTTCCCAAAGGTCCCAGCACCCC
ACTTCCAGAAGACCCCAACTGGAATGTCACTGAGTTCCACACCACGCCCAAGATGTCCACGTACTTGCTG
GCCTTCATTGTCAGTGAGTTCGACTACGTGGAGAAGCAGGCATCCAATGGTGTCTTGATCCGGATCTGGG
CCCGGCCCAGTGCCATTGCGGCGGGCCACGGCGATTATGCCCTGAACGTGACGGGCCCCATCCTTAACTT
CTTTGCTGGTCATTATGACACACCCTACCCACTCCCAAAATCAGACCAGATTGGCCTGCCAGACTTCAAC
GCCGGCGCCATGGAGAACTGGGGACTGGTGACCTACCGGGAGAACTCCCTGCTGTTCGACCCCCTGTCCT
CCTCCAGCAGCAACAAGGAGCGGGTGGTCACTGTGATTGCTCATGAGCTGGCCCACCAGTGGTTCGGGAA
CCTGGTGACCATAGAGTGGTGGAATGACCTGTGGCTGAACGAGGGCTTCGCCTCCTACGTGGAGTACCTG
GGTGCTGACTATGCGGAGCCCACCTGGAACTTGAAAGACCTCATGGTGCTGAATGATGTGTACCGCGTGA
TGGCAGTGGATGCACTGGCCTCCTCCCACCCGCTGTCCACACCCGCCTCGGAGATCAACACGCCGGCCCA
GATCAGTGAGCTGTTTGACGCCATCTCCTACAGCAAGGGCGCCTCAGTCCTCAGGATGCTCTCCAGCTTC
CTGTCCGAGGACGTATTCAAGCAGGGCCTGGCGTCCTACCTCCACACCTTTGCCTACCAGAACACCATCT
ACCTGAACCTGTGGGACCACCTGCAGGAGGCTGTGAACAACCGGTCCATCCAACTCCCCACCACCGTGCG
GGACATCATGAACCGCTGGACCCTGCAGATGGGCTTCCCGGTCATCACGGTGGATACCAGCACGGGGACC
CTTTCCCAGGAGCACTTCCTCCTTGACCCCGATTCCAATGTTACCCGCCCCTCAGAATTCAACTACGTGT
GGATTGTGCCCATCACATCCATCAGAGATGGCAGACAGCAGCAGGACTACTGGCTGATAGATGTAAGAGC
CCAGAACGATCTCTTCAGCACATCAGGCAATGAGTGGGTCCTGCTGAACCTCAATGTGACGGGCTATTAC
CGGGTGAACTACGACGAAGAGAACTGGAGGAAGATTCAGACTCAGCTGCAGAGAGACCACTCGGCCATCC
CTGTCATCAATCGGGCACAGATCATTAATGACGCCTTCAACCTGGCCAGTGCCCATAAGGTCCCTGTCAC
TCTGGCGCTGAACAACACCCTCTTCCTGATTGAAGAGAGACAGTACATGCCCTGGGAGGCCGCCCTGAGC
AGCCTGAGCTACTTCAAGCTCATGTTTGACCGCTCCGAGGTCTATGGCCCCATGAAGAACTACCTGAAGA
AGCAGGTCACACCCCTCTTCATTCACTTCAGAAATAATACCAACAACTGGAGGGAGATCCCAGAAAACCT
GATGGACCAGTACAGCGAGGTTAATGCCATCAGCACCGCCTGCTCCAACGGAGTTCCAGAGTGTGAGGAG
ATGGTCTCTGGCCTTTTCAAGCAGTGGATGGAGAACCCCAATAATAACCCGATCCACCCCAACCTGCGGT
CCACCGTCTACTGCAACGCTATCGCCCAGGGCGGGGAGGAGGAGTGGGACTTCGCCTGGGAGCAGTTCCG
AAATGCCACACTGGTCAATGAGGCTGACAAGCTCCGGGCAGCCCTGGCCTGCAGCAAAGAGTTGTGGATC
CTGAACAGGTACCTGAGCTACACCCTGAACCCGGACTTAATCCGGAAGCAGGACGCCACCTCTACCATCA
TCAGCATTACCAACAACGTCATTGGGCAAGGTCTGGTCTGGGACTTTGTCCAGAGCAACTGGAAGAAGCT
TTTTAACGATTATGGTGGTGGCTCGTTCTCCTTCTCCAACCTCATCCAGGCAGTGACACGACGATTCTCC
ACCGAGTATGAGCTGCAGCAGCTGGAGCAGTTCAAGAAGGACAACGAGGAAACAGGCTTCGGCTCAGGCA
CCCGGGCCCTGGAGCAAGCCCTGGAGAAGACGAAAGCCAACATCAAGTGGGTGAAGGAGAACAAGGAGGT
GGTGCTCCAGTGGTTCACAGAAAACAGCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208950 representing NM_001150
Red=Cloning site Green=Tags(s)

MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKA
WNRYRLPNTLKPDSYQVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLR
GVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATT
QMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLL
AFIVSEFDYVEKQASNGVLIRIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFN
AGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSF
LSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGT
LSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDYWLIDVRAQNDLFSTSGNEWVLLNLNVTGYY
RVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALS
SLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEE
MVSGLFKQWMENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFS
TEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001150
ORF Size 2901 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001150.1, NM_001150.2, NP_001141
RefSeq Size 3494
RefSeq ORF 2904
Locus ID 290
Cytogenetics 15q26.1
Domains Peptidase_M1
Protein Families ES Cell Differentiation/IPS, Transmembrane, Protease, Druggable Genome
Protein Pathways Glutathione metabolism, Metabolic pathways, Renin-angiotensin system, Hematopoietic cell lineage
MW 109.51 kDa
Gene Summary Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)