CTR9 (NM_014633) Human Tagged ORF Clone

CAT#: RC208933

CTR9 (Myc-DDK-tagged)-Human Ctr9, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) (CTR9)

Clone Modification / Custom Cloning Service

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CTR9 (NM_014633) Human Tagged ORF Clone
Symbol CTR9
Synonyms p150; p150TSP; SH2BP1; TSBP
Vector pCMV6-Entry
Sequence Data
>RC208933 representing NM_014633
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCGGGGCTCCATCGAGATTCCCCTCCGGGACACTGACGAGGTCATTGAACTTGACTTCGATCAGT
TACCGGAGGGAGATGAAGTTATCAGTATTCTGAAACAGGAACACACACAACTGCACATATGGATTGCTTT
GGCGCTGGAATACTACAAGCAAGGAAAAACAGAAGAGTTTGTAAAATTGTTGGAAGCAGCACGTATAGAT
GGCAATTTGGACTATAGAGACCATGAAAAAGACCAGATGACTTGCTTGGATACATTGGCAGCGTATTATG
TACAACAGGCTCGGAAAGAAAAGAATAAGGACAATAAAAAGGATCTTATTACACAGGCCACCTTGTTGTA
TACAATGGCCGATAAAATTATTATGTATGATCAGAACCATTTGTTGGGAAGAGCCTGCTTCTGCCTACTT
GAGGGTGACAAAATGGATCAAGCTGATGCACAGTTTCATTTTGTACTCAATCAGTCTCCAAATAATATTC
CAGCCCTTCTTGGTAAAGCTTGCATTTCCTTCAACAAGAAGGATTACAGAGGAGCTCTTGCTTACTATAA
GAAAGCATTGCGTACTAACCCAGGATGTCCAGCGGAAGTTCGTTTAGGAATGGGTCATTGCTTTGTGAAA
CTTAACAAACTGGAAAAAGCTCGTCTGGCATTCAGCAGAGCCCTGGAACTCAATTCCAAATGCGTGGGAG
CATTGGTTGGACTGGCTGTTCTAGAACTCAACAATAAAGAGGCTGATTCCATTAAAAATGGTGTCCAGCT
TCTTTCCAGAGCCTATACTATTGATCCTAGCAACCCTATGGTATTGAACCATTTGGCAAATCACTTTTTC
TTCAAAAAGGATTATAGTAAAGTCCAGCATCTGGCCCTCCATGCATTCCATAATACAGAAGTGGAAGCTA
TGCAAGCAGAGAGCTGCTATCAGCTAGCTAGATCATTCCATGTTCAGGAAGATTATGACCAAGCTTTTCA
GTACTATTATCAAGCCACACAGTTTGCCTCATCCTCTTTTGTGCTCCCATTTTTTGGTTTGGGACAAATG
TATATTTATCGAGGTGACAAAGAAAATGCATCTCAGTGCTTTGAGAAGGTTTTGAAAGCTTATCCTAATA
ATTACGAAACTATGAAAATTCTCGGCTCTCTCTATGCTGCCTCAGAAGATCAAGAAAAACGAGATATTGC
CAAGGGCCATTTGAAGAAGGTCACAGAACAGTATCCCGATGATGTTGAAGCTTGGATTGAATTGGCACAA
ATCTTAGAACAGACTGATATACAGGGTGCCCTTTCAGCCTATGGAACAGCAACACGAATCCTTCAGGAGA
AAGTGCAGGCCGATGTTCCTCCAGAGATTCTCAATAATGTGGGTGCCCTCCATTTTAGACTTGGAAACCT
AGGGGAGGCTAAGAAATATTTTTTGGCGTCATTGGACCGTGCAAAAGCAGAAGCGGAACATGATGAGCAT
TACTATAACGCCATTTCCGTTACCACGTCATATAATCTCGCCAGGCTATATGAGGCGATGTGTGAATTCC
ATGAAGCAGAAAAACTGTATAAAAACATCTTACGCGAACATCCTAATTATGTTGACTGCTATTTGCGCCT
AGGAGCCATGGCTAGAGATAAGGGAAACTTTTATGAGGCTTCAGATTGGTTTAAGGAAGCTCTTCAGATT
AATCAGGATCATCCAGATGCTTGGTCTTTGATTGGCAATCTTCATTTGGCAAAACAAGAATGGGGTCCTG
GGCAGAAGAAGTTTGAGAGGATATTAAAACAGCCATCCACACAGAGTGATACCTATTCTATGCTAGCCCT
TGGCAACGTGTGGCTCCAAACTTTACATCAGCCCACCCGAGATCGAGAAAAGGAAAAGCGTCATCAAGAT
CGTGCTCTGGCCATCTACAAACAAGTACTCAGAAATGATGCAAAGAATCTGTATGCTGCCAATGGCATAG
GAGCTGTTTTGGCCCACAAAGGATATTTTCGTGAAGCTCGTGATGTATTTGCCCAAGTAAGAGAAGCAAC
AGCAGATATTAGTGATGTGTGGCTGAACTTAGCACACATCTATGTGGAGCAAAAGCAGTACATCAGCGCC
GTTCAGATGTATGAAAACTGCCTCCGAAAGTTCTATAAGCACCAAAACACTGAAGTTGTACTCTATTTGG
CCCGGGCCCTCTTCAAGTGTGGCAAGTTACAGGAATGCAAACAGACTTTGCTGAAGGCTAGACATGTGGC
ACCCAGTGATACAGTTCTTATGTTTAATGTGGCCTTGGTCCTGCAAAGATTAGCTACCTCTGTCCTGAAA
GATGAAAAAAGTAATCTGAAGGAAGTACTTAATGCTGTGAAAGAACTGGAGCTTGCACATAGATACTTCA
GTTATTTGAGTAAAGTGGGAGATAAAATGAGATTTGATTTGGCCCTTGCTGCTACAGAAGCCAGGCAGTG
TTCTGACTTACTGAGCCAGGCCCAGTACCATGTGGCCCGGGCACGCAAACAAGATGAAGAAGAGCGGGAG
CTGCGGGCCAAGCAAGAGCAAGAAAAGGAGCTGTTAAGGCAGAAACTTCTTAAAGAACAGGAAGAGAAAC
GTCTCAGAGAAAAGGAAGAGCAAAAGAAACTTTTGGAACAGCGGGCCCAGTATGTGGAGAAGACCAAAAA
TATTCTTATGTTTACTGGTGAGACTGAAGCAACAAAAGAGAAGAAAAGAGGTGGTGGTGGTGGACGGCGT
TCTAAGAAGGGAGGAGAGTTTGATGAATTTGTCAATGATGACACTGATGATGACCTACCTATATCCAAAA
AGAAGAAGAGAAGAAAGGGTAGTGGCAGTGAACAAGAAGGTGAAGATGAGGAGGGTGGTGAGAGAAAGAA
GAAAAAGAGGAGAAGACATCCAAAGGGAGAAGAAGGATCTGATGATGATGAAACAGAAAATGGCCCCAAA
CCAAAAAAACGACGTCCACCAAAAGCAGAGAAGAAAAAGGCTCCCAAGCCAGAACGTCTGCCTCCATCAA
TGAAGGGAAAAATAAAATCCAAAGCCATAATTTCATCAAGTGATGACTCTTCGGATGAGGATAAACTTAA
AATTGCTGATGAAGGACATCCCAGGAACAGCAACAGCAACAGTGACTCAGACGAGGACGAACAACGAAAG
AAATGTGCCTCATCAGAGAGTGATTCCGATGAGAACCAGAACAAGTCTGGCAGCGAGGCCGGCAGTCCCC
GGAGGCCACGAAGACAGCGGTCAGATCAGGACTCAGACAGTGACCAGCCATCCAGAAAGAGAAGGCCCTC
CGGTTCTGAGCAGTCTGACAATGAATCTGTGCAGTCAGGGAGAAGCCACTCAGGAGTTTCTGAGAACGAC
TCTCGCCCAGCTTCTCCAAGTGCCGAATCAGATCACGAATCGGAGAGAGGATCTGATAATGAGGGTTCTG
GCCAAGGCTCTGGAAATGAATCGGAACCAGAGGGATCCAACAATGAGGCCTCAGATAGAGGCTCAGAACA
TGGGTCAGATGATAGTGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208933 representing NM_014633
Red=Cloning site Green=Tags(s)

MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARID
GNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLL
EGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVK
LNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFF
FKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQM
YIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQ
ILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEHDEH
YYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQI
NQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQTLHQPTRDREKEKRHQD
RALAIYKQVLRNDAKNLYAANGIGAVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISA
VQMYENCLRKFYKHQNTEVVLYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLK
DEKSNLKEVLNAVKELELAHRYFSYLSKVGDKMRFDLALAATEARQCSDLLSQAQYHVARARKQDEEERE
LRAKQEQEKELLRQKLLKEQEEKRLREKEEQKKLLEQRAQYVEKTKNILMFTGETEATKEKKRGGGGGRR
SKKGGEFDEFVNDDTDDDLPISKKKKRRKGSGSEQEGEDEEGGERKKKKRRRHPKGEEGSDDDETENGPK
PKKRRPPKAEKKKAPKPERLPPSMKGKIKSKAIISSSDDSSDEDKLKIADEGHPRNSNSNSDSDEDEQRK
KCASSESDSDENQNKSGSEAGSPRRPRRQRSDQDSDSDQPSRKRRPSGSEQSDNESVQSGRSHSGVSEND
SRPASPSAESDHESERGSDNEGSGQGSGNESEPEGSNNEASDRGSEHGSDDSD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014633
ORF Size 3519 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014633.1, NM_014633.2, NM_014633.3, NM_014633.4, NP_055448
RefSeq Size 4348
RefSeq ORF 3522
Locus ID 9646
Cytogenetics 11p15.4
Domains TPR
Protein Families Protease
MW 133.3 kDa
Gene Summary The protein encoded by this gene is a component of the PAF1 complex, which associates with RNA polymerase II and functions in transcriptional regulation and elongation. This complex also plays a role in the modification of histones. [provided by RefSeq, Oct 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)