ICAM3 (NM_002162) Human Tagged ORF Clone

CAT#: RC208919

Reviews ()
Write a review

ICAM3 (Myc-DDK-tagged)-Human intercellular adhesion molecule 3 (ICAM3)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 509.00


Availability*
In Stock

Size
    • 10 ug


Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ICAM3
Synonyms CD50; CDW50; ICAM-R
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208919 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCATGGTACCATCCGTGTTGTGGCCCAGGGCCTGCTGGACTCTGCTGGTCTGCTGTCTGCTGA
CCCCAGGTGTCCAGGGGCAGGAGTTCCTTTTGCGGGTGGAGCCCCAGAACCCTGTGCTCTCTGCTGGAGG
GTCCCTGTTTGTGAACTGCAGTACTGATTGTCCCAGCTCTGAGAAAATCGCCTTGGAGACGTCCCTATCA
AAGGAGCTGGTGGCCAGTGGCATGGGCTGGGCAGCCTTCAATCTCAGCAACGTGACTGGCAACAGTCGGA
TCCTCTGCTCAGTGTACTGCAATGGCTCCCAGATAACAGGCTCCTCTAACATCACCGTGTACAGGCTCCC
GGAGCGTGTGGAGCTGGCACCCCTGCCTCCTTGGCAGCCGGTGGGCCAGAACTTCACCCTGCGCTGCCAA
GTGGAGGATGGGTCGCCCCGGACCAGCCTCACGGTGGTGCTGCTTCGCTGGGAGGAGGAGCTGAGCCGGC
AGCCCGCAGTGGAGGAGCCAGCGGAGGTCACTGCCACTGTGCTGGCCAGCAGAGACGACCACGGAGCCCC
TTTCTCATGCCGCACAGAACTGGACATGCAGCCCCAGGGGCTGGGACTGTTCGTGAACACCTCAGCCCCC
CGCCAGCTCCGAACCTTTGTCCTGCCCGTGACCCCCCCGCGCCTCGTGGCCCCCCGGTTCTTGGAGGTGG
AAACGTCGTGGCCGGTGGACTGCACCCTAGACGGGCTTTTTCCAGCCTCAGAGGCCCAGGTCTACCTGGC
GCTGGGGGACCAGATGCTGAATGCGACAGTCATGAACCACGGGGACACGCTAACGGCCACAGCCACAGCC
ACGGCGCGCGCGGATCAGGAGGGTGCCCGGGAGATCGTCTGCAACGTGACCCTAGGGGGCGAGAGACGGG
AGGCCCGGGAGAACTTGACGGTCTTTAGCTTCCTAGGACCCATTGTGAACCTCAGCGAGCCCACCGCCCA
TGAGGGGTCCACAGTGACCGTGAGTTGCATGGCTGGGGCTCGAGTCCAGGTCACGCTGGACGGAGTTCCG
GCCGCGGCCCCGGGGCAGCCAGCTCAACTTCAGCTAAATGCTACCGAGAGTGACGACGGACGCAGCTTCT
TCTGCAGTGCCACTCTCGAGGTGGACGGCGAGTTCTTGCACAGGAACAGTAGCGTCCAGCTGCGAGTCCT
GTATGGTCCCAAAATTGACCGAGCCACATGCCCCCAGCACTTGAAATGGAAAGATAAAACGAGACACGTC
CTGCAGTGCCAAGCCAGGGGCAACCCGTACCCCGAGCTGCGGTGTTTGAAGGAAGGCTCCAGCCGGGAGG
TGCCGGTGGGGATCCCGTTCTTCGTCAACGTAACACATAATGGTACTTATCAGTGCCAAGCGTCCAGCTC
ACGAGGCAAATACACCCTGGTCGTGGTGATGGACATTGAGGCTGGGAGCTCCCACTTTGTCCCCGTCTTC
GTGGCGGTGTTACTGACCCTGGGCGTGGTGACTATCGTACTGGCCTTAATGTACGTCTTCAGGGAGCACC
AACGGAGCGGCAGTTACCATGTTAGGGAGGAGAGCACCTATCTGCCCCTCACGTCTATGCAGCCGACAGA
AGCAATGGGGGAAGAACCGTCCAGAGCTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208919 protein sequence
Red=Cloning site Green=Tags(s)

MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLS
KELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQ
VEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVNTSAP
RQLRTFVLPVTPPRLVAPRFLEVETSWPVDCTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATA
TARADQEGAREIVCNVTLGGERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVSCMAGARVQVTLDGVP
AAAPGQPAQLQLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTRHV
LQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQCQASSSRGKYTLVVVMDIEAGSSHFVPVF
VAVLLTLGVVTIVLALMYVFREHQRSGSYHVREESTYLPLTSMQPTEAMGEEPSRAE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002162
ORF Size 1641 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002162.5
RefSeq Size 1796 bp
RefSeq ORF 1644 bp
Locus ID 3385
UniProt ID P32942
Cytogenetics 19p13.2
Domains ig, IG, ICAM_N
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
MW 59.5 kDa
Gene Summary The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is constitutively and abundantly expressed by all leucocytes and may be the most important ligand for LFA-1 in the initiation of the immune response. It functions not only as an adhesion molecule, but also as a potent signalling molecule. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016]
Other products for "ICAM3"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.