UGT(UGT1A9) (NM_021027) Human Tagged ORF Clone

CAT#: RC208861

UGT1A9 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name UGT(UGT1A9) (NM_021027) Human Tagged ORF Clone
Symbol UGT1A9
Synonyms HLUGP4; LUGP4; UDPGT; UDPGT 1-9; UGT-1I; UGT1-09; UGT1-9; UGT1.9; UGT1A9S; UGT1AI; UGT1I
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208861 representing NM_021027
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTGCACAGGGTGGACCAGCCCCCTTCCTCTATGTGTGTGTCTGCTGCTGACCTGTGGCTTTGCCG
AGGCAGGGAAGCTACTGGTAGTGCCCATGGATGGGAGCCACTGGTTCACCATGAGGTCGGTGGTGGAGAA
ACTCATTCTCAGGGGGCATGAGGTGGTTGTAGTCATGCCAGAGGTGAGTTGGCAACTGGGAAGATCACTG
AATTGCACAGTGAAGACTTATTCAACTTCATATACCCTGGAGGATCTGGACCGGGAGTTCAAGGCTTTTG
CCCATGCTCAATGGAAAGCACAAGTACGAAGTATATATTCTCTATTAATGGGTTCATACAATGACATTTT
TGACTTATTTTTTTCAAATTGCAGGAGTTTGTTTAAAGACAAAAAATTAGTAGAATACTTAAAGGAGAGT
TCTTTTGATGCAGTGTTTCTCGATCCTTTTGATAACTGTGGCTTAATTGTTGCCAAATATTTCTCCCTCC
CCTCCGTGGTCTTCGCCAGGGGAATACTTTGCCACTATCTTGAAGAAGGTGCACAGTGCCCTGCTCCTCT
TTCCTATGTCCCCAGAATTCTCTTAGGGTTCTCAGATGCCATGACTTTCAAGGAGAGAGTACGGAACCAC
ATCATGCACTTGGAGGAACATTTATTATGCCACCGTTTTTTCAAAAATGCCCTAGAAATAGCCTCTGAAA
TTCTCCAAACACCTGTTACGGAGTATGATCTCTACAGCCACACATCAATTTGGTTGTTGCGAACGGACTT
TGTTTTGGACTATCCCAAACCCGTGATGCCCAACATGATCTTCATTGGTGGTATCAACTGCCATCAGGGA
AAGCCGTTGCCTATGGAATTTGAAGCCTACATTAATGCTTCTGGAGAACATGGAATTGTGGTTTTCTCTT
TGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTATGGCAATTGCTGATGCTTTGGGCAAAATCCC
TCAGACAGTCCTGTGGCGGTACACTGGAACCCGACCATCGAATCTTGCGAACAACACGATACTTGTTAAG
TGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACCCGTGCCTTTATCACCCATGCTGGTTCCCATG
GTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCTTGTTTGGTGATCAGATGGACAA
TGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAATGTTCTGGAAATGACTTCTGAAGATTTA
GAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATGCGCCTCTCCAGCCTTC
ACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGATGAGGCACAAGGG
CGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGACGTGATTGGT
TTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTATGGCTACCGGAAAT
GCTTGGGGAAAAAAGGGCGAGTTAAGAAAGCCCACAAATCCAAGACCCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208861 representing NM_021027
Red=Cloning site Green=Tags(s)

MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSL
NCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKES
SFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNH
IMHLEEHLLCHRFFKNALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG
KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021027
ORF Size 1590 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021027.1, NM_021027.2, NP_066307
RefSeq Size 2395
RefSeq ORF 1593
Locus ID 54600
Cytogenetics 2q37.1
Domains UDPGT
Protein Families Transmembrane, Druggable Genome
Protein Pathways Pentose and glucuronate interconversions, Ascorbate and aldarate metabolism, Androgen and estrogen metabolism, Starch and sucrose metabolism, Retinol metabolism, Porphyrin and chlorophyll metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways
MW 57.3 kDa
Gene Summary This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations