HOXC9 (NM_006897) Human Tagged ORF Clone

CAT#: RC208833

HOXC9 (Myc-DDK-tagged)-Human homeobox C9 (HOXC9)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HOXC9 (NM_006897) Human Tagged ORF Clone
Symbol HOXC9
Synonyms HOX3; HOX3B
Vector pCMV6-Entry
Sequence Data
>RC208833 representing NM_006897
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCGACGGGGCCCATCAGTAACTATTACGTGGACTCGCTCATCTCTCACGACAATGAAGACCTCC
TAGCGTCCAGGTTTCCGGCCACCGGGGCTCATCCCGCCGCCGCCAGACCCAGCGGTTTGGTGCCGGACTG
TAGCGATTTTCCGTCCTGTAGCTTCGCGCCCAAGCCGGCAGTGTTCAGCACGTCGTGGGCGCCCGTGCCC
TCTCAGTCGTCCGTGGTATATCACCCGTACGGCCCCCAGCCCCACCTCGGCGCCGACACGCGCTACATGC
GGACTTGGCTCGAGCCGCTGTCCGGCGCCGTCTCCTTCCCCAGCTTCCCGGCCGGGGGCCGTCACTACGC
CCTCAAGCCGGACGCCTACCCCGGGCGCCGCGCGGACTGCGGCCCAGGGGAGGGCCGCAGCTACCCGGAC
TACATGTACGGCTCGCCCGGGGAGCTGCGCGACCGCGCCCCGCAGACACTGCCCTCGCCCGAGGCGGACG
CGCTCGCCGGCAGCAAGCACAAAGAGGAGAAGGCTGACCTGGACCCCAGCAACCCCGTGGCCAACTGGAT
TCACGCCCGCTCCACGAGGAAGAAGCGCTGCCCCTACACCAAGTACCAGACGCTGGAACTGGAGAAGGAG
TTTCTCTTCAATATGTATTTAACCAGGGACCGTCGGTATGAGGTGGCCCGGGTTCTCAATCTCACCGAGC
GGCAGGTCAAAATCTGGTTTCAGAATCGAAGGATGAAGATGAAAAAGATGAATAAAGAGAAAACCGACAA
GGAGCAGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208833 representing NM_006897
Red=Cloning site Green=Tags(s)

MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVP
SQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPD
YMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKE
FLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006897
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006897.1, NM_006897.2, NP_008828
RefSeq Size 1640
RefSeq ORF 783
Locus ID 3225
Cytogenetics 12q13.13
Protein Families Transcription Factors
MW 29.1 kDa
Gene Summary Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)