ARHGAP30 (NM_181720) Human Tagged ORF Clone

CAT#: RC208825

ARHGAP30 (Myc-DDK-tagged)-Human Rho GTPase activating protein 30 (ARHGAP30), transcript variant 2

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARHGAP30 (NM_181720) Human Tagged ORF Clone
Symbol ARHGAP30
Synonyms RP11-544M22.6
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208825 representing NM_181720
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCCGGCGC
GCC
C

ATGAAGTCTCGGCAGAAAGGAAAGAAGAAGGGCAGCGCAAAGGAGCGGGTTTTTGGGTGCGACTTGCAGG
AGCACCTGCAGCACTCAGGCCAGGAGGTGCCCCAGGTGCTAAAGAGCTGTGCAGAATTTGTGGAGGAGTA
TGGAGTGGTGGATGGGATCTACCGCCTCTCAGGGGTCTCCTCCAACATCCAGAAGCTTCGGCAGGAATTG
GAGTCAGAGCGGAAGCCAGACCTGCGTCGGGATGTTTACCTCCAAGACATTCACTGCGTCTCCTCCCTGT
GCAAGGCCTATTTCAGAGAACTGCCGGATCCCCTGCTCACTTACCGGCTCTATGACAAGTTTGCTGAGGC
TGTAGGAGTGCAATTGGAACCTGAGCGCTTGGTCAAGATCCTAGAGGTGCTTCGGGAACTCCCTGTCCCA
AACTACAGGACCCTGGAGTTCCTCATGAGGCACTTGGTACACATGGCCTCATTCAGTGCCCAGACCAACA
TGCATGCTCGCAACCTGGCCATCGTGTGGGCTCCCAACCTGCTGAGGTCTAAGGACATAGAGGCCTCAGG
CTTCAATGGGACAGCGGCCTTCATGGAGGTGCGGGTACAATCCATCGTCGTGGAGTTCATCCTCACACAC
GTGGACCAGCTCTTTGGGGGTGCTGCCCTCTCTGGTGGTGAGGTGGAGAGTGGGTGGCGATCGCTTCCAG
GGACCCGGGCATCAGGCAGCCCCGAGGACCTTATGCCCAGGCCACTGCCTTATCACCTGCCTAGCATACT
GCAGGCTGGCGATGGACCCCCACAGATGCGGCCCTACCATACTATCATCGAGATTGCAGAGCACAAGAGG
AAGGGGTCTTTGAAGGTCAGGAAGTGGAGGTCTATCTTCAATTTAGGTCGCTCTGGCCATGAGACTAAGC
GTAAACTTCCACGGGGGGCTGAGGACAGGGAGGATAAATCCAACAAGGGGACACTGCGGCCAGCCAAAAG
CATGGACTCACTGAGTGCTGCAGCTGGGGCCAGTGATGAGCCAGAGGGGCTGGTGGGGCCCAGCAGCCCC
CGGCCAAGCCCATTGCTGCCTGAGAGCTTGGAGAACGATTCTATAGAGGCAGCAGAGGGTGAACAGGAGC
CTGAGGCAGAAGCACTGGGTGGCACAAACTCTGAACCAGGCACACCACGAGCTGGGCGGTCAGCCATCCG
GGCTGGGGGCAGCAGCCGTGCAGAACGCTGTGCTGGTGTCCACATCTCAGACCCCTACAATGTCAACCTC
CCGCTACACATCACCTCTATCCTCAGTGTGCCCCCGAACATCATCTCTAACGTTTCCTTGGCCAGGCTCA
CCCGTGGCCTTGAGTGCCCTGCTCTACAGCACCGGCCAAGCCCTGCCTCTGGCCCTGGCCCTGGCCCTGG
CCTTGGCCCTGGCCCCCCAGATGAAAAGTTGGAAGCAAGTCCAGCCTCAAGTCCCCTGGCAGACTCAGGC
CCAGACGACTTGGCTCCTGCCCTGGAGGACTCGCTGTCCCAGGAGGTGCAGGACTCCTTCTCCTTCCTAG
AGGACTCAAGCAGCTCAGAACCTGAGTGGGTGGGGGCAGAGGATGGGGAGGTGGCCCAGGCAGAAGCAGC
AGGAGCAGCCTTCTCCCCTGGGGAGGACGACCCTGGGATGGGCTACCTGGAGGAGCTCCTGGGAGTTGGG
CCTCAGGTGGAGGAGTTCTCTGTGGAGCCACCCCTGGATGACCTGTCTCTGGATGAGGCACAGTTTGTCT
TGGCCCCCAGCTGCTGTTCCGTGGACTCCGCTGGCCCCAGGCCTGAAGTTGAGGAGGAAAATGGGGAGGA
AGTTTTCCTGAGTGCCTATGATGACCTAAGTCCCCTTCTGGGACCTAAACCCCCAATCTGGAAGGGTTCA
GGGAGTCTGGAGGGAGAGGCAGCAGGATGTGGAAGGCAGGCTCTGGGACAGGGTGGGGAAGAGCAGGCAT
GCTGGGAAGTTGGGGAGGACAAGCAGGCTGAGCCTGGAGGCAGGCTAGACATCAGGGAAGAGGCAGAGGG
AAGTCCACAGCCACCTCAGCCAGAGGAGATGGAGCCTGAGGGGCAGCCCAGTCCAGACGGCTGTCTATGC
CCCTGTTCTCTTGGCCTGGGTGGCGTGGGCATGCGTCTAGCTTCCACTCTGGTTCAGGTCCAACAGGTCC
GCTCTGTGCCTGTGGTGCCCCCCAAGCCACAGTTTGCCAAGATGCCCAGTGCAATGTGTAGCAAGATTCA
TGTGGCACCTGCAAATCCATGCCCGAGGCCTGGCCGGCTTGATGGGACTCCTGGAGAAAGGGCTTGGGGG
TCCCGAGCTTCTCGATCCTCTTGGAGGAATGGGGGTAGTCTTTCCTTTGATGCTGCTGTGGCCCTAGCCC
GGGACCGCCAAAGGACTGAGGCTCAAGGAGTTCGGCGAACCCAGACCTGTACTGAGGGTGGGGATTACTG
CCTCATCCCCAGAACCTCCCCTTGTAGCATGATCTCTGCCCATTCTCCTCGGCCCCTTAGCTGCCTGGAG
CTCCCATCTGAAGGTGCAGAAGGGTCTGGATCCCGGAGTCGTCTTAGTCTGCCCCCCAGAGAACCCCAGG
TTCCTGACCCCCTGTTGTCCTCTCAGCGCAGATCATATGCATTTGAAACACAGGCTAACCCTGGGAAAGG
TGAAGGACTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208825 representing NM_181720
Red=Cloning site Green=Tags(s)

MKSRQKGKKKGSAKERVFGCDLQEHLQHSGQEVPQVLKSCAEFVEEYGVVDGIYRLSGVSSNIQKLRQEL
ESERKPDLRRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPERLVKILEVLRELPVP
NYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRSKDIEASGFNGTAAFMEVRVQSIVVEFILTH
VDQLFGGAALSGGEVESGWRSLPGTRASGSPEDLMPRPLPYHLPSILQAGDGPPQMRPYHTIIEIAEHKR
KGSLKVRKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAGASDEPEGLVGPSSP
RPSPLLPESLENDSIEAAEGEQEPEAEALGGTNSEPGTPRAGRSAIRAGGSSRAERCAGVHISDPYNVNL
PLHITSILSVPPNIISNVSLARLTRGLECPALQHRPSPASGPGPGPGLGPGPPDEKLEASPASSPLADSG
PDDLAPALEDSLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAAFSPGEDDPGMGYLEELLGVG
PQVEEFSVEPPLDDLSLDEAQFVLAPSCCSVDSAGPRPEVEEENGEEVFLSAYDDLSPLLGPKPPIWKGS
GSLEGEAAGCGRQALGQGGEEQACWEVGEDKQAEPGGRLDIREEAEGSPQPPQPEEMEPEGQPSPDGCLC
PCSLGLGGVGMRLASTLVQVQQVRSVPVVPPKPQFAKMPSAMCSKIHVAPANPCPRPGRLDGTPGERAWG
SRASRSSWRNGGSLSFDAAVALARDRQRTEAQGVRRTQTCTEGGDYCLIPRTSPCSMISAHSPRPLSCLE
LPSEGAEGSGSRSRLSLPPREPQVPDPLLSSQRRSYAFETQANPGKGEGL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites AscI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_181720
ORF Size 2670 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_181720.1, NM_181720.2, NP_859071
RefSeq Size 3888
RefSeq ORF 2673
Locus ID 257106
Cytogenetics 1q23.3
MW 95.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations