C15orf38 (ARPIN) (NM_182616) Human Tagged ORF Clone

CAT#: RC208793

C15orf38 (Myc-DDK-tagged)-Human chromosome 15 open reading frame 38 (C15orf38)

Product Images

Western blot validation of overexpression lysate (Cat# LY405459) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC208793 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified ARPIN protein (Cat# TP308793). The protein was produced from HEK293T cells transfected with ARPIN cDNA clone (Cat# RC208793) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: ARPIN
• Synonyms: C15orf38
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC208793 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGCCGCATCTACCACGACGGCGCGCTCCGGAACAAGGCGGTGCAGAGCGTCCGGCTGCCAGGGGCCT
  GGGACCCCGCCGCCCACCAGGGGGGAAATGGTGTCCTGCTGGAGGGAGAACTGATCGATGTATCTCGGCA
  CAGCATCTTGGACACTCATGGCAGGAAGGAGCGCTACTACGTGCTGTATATCCGGCCCAGTCACATCCAT
  CGCCGTAAATTCGACGCCAAGGGAAATGAAATCGAGCCCAACTTCAGCGCCACCAGGAAGGTGAACACGG
  GCTTCCTCATGTCGTCCTACAAGGTGGAAGCCAAGGGGGACACTGACAGGCTCACGCCCGAGGCGCTGAA
  GGGGCTGGTCAACAAGCCAGAGCTGCTCGCGCTGACAGAGAGCCTCACCCCCGACCACACAGTGGCGTTC
  TGGATGCCCGAGTCAGAGATGGAGGTGATGGAACTCGAGCTGGGGGCCGGGGTACGGCTGAAGACTCGGG
  GCGATGGTCCCTTCCTGGATTCATTGGCCAAACTTGAGGCTGGAACAGTGACCAAGTGTAATTTCACTGG
  TGATGGAAAGACAGGGGCATCCTGGACAGACAACATCATGGCCCAAAAGTGTTCGAAGGGGGCTGCAGCG
  GAGATCCGAGAGCAGGGGGATGGGGCAGAGGACGAGGAGTGGGATGAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC208793 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIH
  RRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAF
  WMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAA
  EIREQGDGAEDEEWDD
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_182616
• ORF Size: 678 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_182616.4
• RefSeq Size: 6114 bp
• RefSeq ORF: 681 bp
• Locus ID: 348110
• UniProt ID: Q7Z6K5
• Cytogenetics: 15q26.1
• MW: 24.9 kDa
• Gene Summary: Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence.[UniProtKB/Swiss-Prot Function]