C15orf38(ARPIN) (NM_182616) Human Tagged ORF Clone

CAT#: RC208793

C15orf38 (Myc-DDK-tagged)-Human chromosome 15 open reading frame 38 (C15orf38)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name C15orf38(ARPIN) (NM_182616) Human Tagged ORF Clone
Symbol ARPIN
Synonyms C15orf38; C15orf38
Vector pCMV6-Entry
Sequence Data
>RC208793 representing NM_182616
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCGCATCTACCACGACGGCGCGCTCCGGAACAAGGCGGTGCAGAGCGTCCGGCTGCCAGGGGCCT
GGGACCCCGCCGCCCACCAGGGGGGAAATGGTGTCCTGCTGGAGGGAGAACTGATCGATGTATCTCGGCA
CAGCATCTTGGACACTCATGGCAGGAAGGAGCGCTACTACGTGCTGTATATCCGGCCCAGTCACATCCAT
CGCCGTAAATTCGACGCCAAGGGAAATGAAATCGAGCCCAACTTCAGCGCCACCAGGAAGGTGAACACGG
GCTTCCTCATGTCGTCCTACAAGGTGGAAGCCAAGGGGGACACTGACAGGCTCACGCCCGAGGCGCTGAA
GGGGCTGGTCAACAAGCCAGAGCTGCTCGCGCTGACAGAGAGCCTCACCCCCGACCACACAGTGGCGTTC
TGGATGCCCGAGTCAGAGATGGAGGTGATGGAACTCGAGCTGGGGGCCGGGGTACGGCTGAAGACTCGGG
GCGATGGTCCCTTCCTGGATTCATTGGCCAAACTTGAGGCTGGAACAGTGACCAAGTGTAATTTCACTGG
TGATGGAAAGACAGGGGCATCCTGGACAGACAACATCATGGCCCAAAAGTGTTCGAAGGGGGCTGCAGCG
GAGATCCGAGAGCAGGGGGATGGGGCAGAGGACGAGGAGTGGGATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208793 representing NM_182616
Red=Cloning site Green=Tags(s)

MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIH
RRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAF
WMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAA
EIREQGDGAEDEEWDD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_182616
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_182616.1, NM_182616.2, NM_182616.3, NP_872422
RefSeq Size 2065
RefSeq ORF 681
Locus ID 348110
Cytogenetics 15q26.1
MW 24.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)