C15orf38 (ARPIN) (NM_182616) Human Tagged ORF Clone

CAT#: RC208793

C15orf38 (Myc-DDK-tagged)-Human chromosome 15 open reading frame 38 (C15orf38)



  "NM_182616" in other vectors (4)

Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "ARPIN"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ARPIN
Synonyms C15orf38
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208793 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCGCATCTACCACGACGGCGCGCTCCGGAACAAGGCGGTGCAGAGCGTCCGGCTGCCAGGGGCCT
GGGACCCCGCCGCCCACCAGGGGGGAAATGGTGTCCTGCTGGAGGGAGAACTGATCGATGTATCTCGGCA
CAGCATCTTGGACACTCATGGCAGGAAGGAGCGCTACTACGTGCTGTATATCCGGCCCAGTCACATCCAT
CGCCGTAAATTCGACGCCAAGGGAAATGAAATCGAGCCCAACTTCAGCGCCACCAGGAAGGTGAACACGG
GCTTCCTCATGTCGTCCTACAAGGTGGAAGCCAAGGGGGACACTGACAGGCTCACGCCCGAGGCGCTGAA
GGGGCTGGTCAACAAGCCAGAGCTGCTCGCGCTGACAGAGAGCCTCACCCCCGACCACACAGTGGCGTTC
TGGATGCCCGAGTCAGAGATGGAGGTGATGGAACTCGAGCTGGGGGCCGGGGTACGGCTGAAGACTCGGG
GCGATGGTCCCTTCCTGGATTCATTGGCCAAACTTGAGGCTGGAACAGTGACCAAGTGTAATTTCACTGG
TGATGGAAAGACAGGGGCATCCTGGACAGACAACATCATGGCCCAAAAGTGTTCGAAGGGGGCTGCAGCG
GAGATCCGAGAGCAGGGGGATGGGGCAGAGGACGAGGAGTGGGATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208793 protein sequence
Red=Cloning site Green=Tags(s)

MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIH
RRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAF
WMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAA
EIREQGDGAEDEEWDD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_182616
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_182616.4
RefSeq Size 6114 bp
RefSeq ORF 681 bp
Locus ID 348110
UniProt ID Q7Z6K5
Cytogenetics 15q26.1
MW 24.9 kDa
Gene Summary Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.