GDA (NM_004293) Human Tagged ORF Clone

CAT#: RC208771

Reviews ()
Write a review

GDA (Myc-DDK-tagged)-Human guanine deaminase (GDA)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GDA
Synonyms CYPIN; GAH; GUANASE; NEDASIN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208771 representing NM_004293
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGCCGCTCAGATGCCGCCCCTGGCGCACATCTTCCGAGGGACGTTCGTCCACTCCACCTGGACCT
GCCCCATGGAGGTGCTGCGGGATCACCTCCTCGGCGTGAGCGACAGCGGCAAAATAGTGTTTTTAGAAGA
AGCATCTCAACAGGAAAAACTGGCCAAAGAATGGTGCTTCAAGCCGTGTGAAATAAGAGAACTGAGCCAC
CATGAGTTCTTCATGCCTGGGCTGGTTGATACACACATCCATGCCTCTCAGTATTCCTTTGCTGGAAGTA
GCATAGACCTGCCACTCTTGGAGTGGCTGACCAAGTACACATTTCCTGCAGAACACAGATTCCAGAACAT
CGACTTTGCAGAAGAAGTATATACCAGAGTTGTCAGGAGAACACTAAAGAATGGAACAACCACAGCTTGT
TACTTTGCAACAATTCACACTGACTCATCTCTGCTCCTTGCCGACATTACAGATAAATTTGGACAGCGGG
CATTTGTGGGCAAAGTTTGCATGGATTTGAATGACACTTTTCCAGAATACAAGGAGACCACTGAGGAATC
GATCAAGGAAACTGAGAGATTTGTGTCAGAAATGCTCCAAAAGAACTATTCTAGAGTGAAGCCCATAGTG
ACACCACGTTTTTCCCTCTCCTGCTCTGAGACTTTGATGGGTGAACTGGGCAACATTGCTAAAACCCGTG
ATTTGCACATTCAGAGCCATATAAGTGAAAATCGTGATGAAGTTGAAGCTGTGAAAAACTTATACCCCAG
TTATAAAAACTACACATCTGTGTATGATAAAAACAATCTTTTGACAAATAAGACAGTGATGGCACACGGC
TGCTACCTCTCTGCAGAAGAACTGAACGTATTCCATGAACGAGGAGCATCCATCGCACACTGTCCCAATT
CTAATTTATCGCTCAGCAGTGGATTTCTAAATGTGCTAGAAGTCCTGAAACATGAAGTCAAGATAGGGCT
GGGTACAGACGTGGCTGGTGGCTATTCATATTCCATGCTTGATGCAATCAGAAGAGCAGTGATGGTTTCC
AATATCCTTTTAATTAATAAGGTAAATGAGAAAAGCCTCACCCTCAAAGAAGTCTTCAGACTAGCTACTC
TTGGAGGAAGCCAAGCCCTGGGGCTGGATGGTGAGATTGGAAACTTTGAAGTGGGCAAGGAATTTGATGC
CATCCTGATCAACCCCAAAGCATCCGACTCTCCCATTGACCTGTTTTATGGGGACTTTTTTGGTGATATT
TCTGAGGCTGTTATCCAGAAGTTCCTCTATCTAGGAGATGATCGAAATATTGAAGAGGTTTATGTGGGCG
GAAAGCAGGTGGTTCCGTTTTCCAGCTCAGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208771 representing NM_004293
Red=Cloning site Green=Tags(s)

MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSH
HEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTAC
YFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKETERFVSEMLQKNYSRVKPIV
TPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHG
CYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVS
NILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004293
ORF Size 1362 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004293.5
RefSeq Size 5430 bp
RefSeq ORF 1365 bp
Locus ID 9615
UniProt ID Q9Y2T3
Cytogenetics 9q21.13
Domains Amidohydro_1
Protein Pathways Metabolic pathways, Purine metabolism
MW 50.8 kDa
Gene Summary This gene encodes an enzyme responsible for the hydrolytic deamination of guanine. Studies in rat ortholog suggest this gene plays a role in microtubule assembly. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.