GDA (NM_004293) Human Tagged ORF Clone

CAT#: RC208771

GDA (Myc-DDK-tagged)-Human guanine deaminase (GDA)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GDA (NM_004293) Human Tagged ORF Clone
Symbol GDA
Synonyms CYPIN; GUANASE; NEDASIN
Vector pCMV6-Entry
Sequence Data
>RC208771 representing NM_004293
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGCCGCTCAGATGCCGCCCCTGGCGCACATCTTCCGAGGGACGTTCGTCCACTCCACCTGGACCT
GCCCCATGGAGGTGCTGCGGGATCACCTCCTCGGCGTGAGCGACAGCGGCAAAATAGTGTTTTTAGAAGA
AGCATCTCAACAGGAAAAACTGGCCAAAGAATGGTGCTTCAAGCCGTGTGAAATAAGAGAACTGAGCCAC
CATGAGTTCTTCATGCCTGGGCTGGTTGATACACACATCCATGCCTCTCAGTATTCCTTTGCTGGAAGTA
GCATAGACCTGCCACTCTTGGAGTGGCTGACCAAGTACACATTTCCTGCAGAACACAGATTCCAGAACAT
CGACTTTGCAGAAGAAGTATATACCAGAGTTGTCAGGAGAACACTAAAGAATGGAACAACCACAGCTTGT
TACTTTGCAACAATTCACACTGACTCATCTCTGCTCCTTGCCGACATTACAGATAAATTTGGACAGCGGG
CATTTGTGGGCAAAGTTTGCATGGATTTGAATGACACTTTTCCAGAATACAAGGAGACCACTGAGGAATC
GATCAAGGAAACTGAGAGATTTGTGTCAGAAATGCTCCAAAAGAACTATTCTAGAGTGAAGCCCATAGTG
ACACCACGTTTTTCCCTCTCCTGCTCTGAGACTTTGATGGGTGAACTGGGCAACATTGCTAAAACCCGTG
ATTTGCACATTCAGAGCCATATAAGTGAAAATCGTGATGAAGTTGAAGCTGTGAAAAACTTATACCCCAG
TTATAAAAACTACACATCTGTGTATGATAAAAACAATCTTTTGACAAATAAGACAGTGATGGCACACGGC
TGCTACCTCTCTGCAGAAGAACTGAACGTATTCCATGAACGAGGAGCATCCATCGCACACTGTCCCAATT
CTAATTTATCGCTCAGCAGTGGATTTCTAAATGTGCTAGAAGTCCTGAAACATGAAGTCAAGATAGGGCT
GGGTACAGACGTGGCTGGTGGCTATTCATATTCCATGCTTGATGCAATCAGAAGAGCAGTGATGGTTTCC
AATATCCTTTTAATTAATAAGGTAAATGAGAAAAGCCTCACCCTCAAAGAAGTCTTCAGACTAGCTACTC
TTGGAGGAAGCCAAGCCCTGGGGCTGGATGGTGAGATTGGAAACTTTGAAGTGGGCAAGGAATTTGATGC
CATCCTGATCAACCCCAAAGCATCCGACTCTCCCATTGACCTGTTTTATGGGGACTTTTTTGGTGATATT
TCTGAGGCTGTTATCCAGAAGTTCCTCTATCTAGGAGATGATCGAAATATTGAAGAGGTTTATGTGGGCG
GAAAGCAGGTGGTTCCGTTTTCCAGCTCAGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208771 representing NM_004293
Red=Cloning site Green=Tags(s)

MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSH
HEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTAC
YFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKETERFVSEMLQKNYSRVKPIV
TPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHG
CYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVS
NILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004293
ORF Size 1362 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004293.1, NM_004293.2, NM_004293.3, NM_004293.4, NP_004284
RefSeq Size 5430
RefSeq ORF 1365
Locus ID 9615
Cytogenetics 9q21.13
Domains Amidohydro_1
Protein Pathways Purine metabolism, Metabolic pathways
MW 50.8 kDa
Gene Summary This gene encodes an enzyme responsible for the hydrolytic deamination of guanine. Studies in rat ortholog suggest this gene plays a role in microtubule assembly. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)