RbAp48 (RBBP4) (NM_005610) Human Tagged ORF Clone

CAT#: RC208761

Reviews ()
Write a review

RBBP4 (Myc-DDK-tagged)-Human retinoblastoma binding protein 4 (RBBP4), transcript variant 1



  "NM_005610" in other vectors (5)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RBBP4
Synonyms lin-53; NURF55; RBAP48
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208761 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACAAGGAAGCAGCCTTCGACGACGCAGTGGAAGAACGAGTGATCAACGAGGAATACAAAATAT
GGAAAAAGAACACCCCTTTTCTTTATGATTTGGTGATGACCCATGCTCTGGAGTGGCCCAGCCTAACTGC
CCAGTGGCTTCCAGATGTAACCAGACCAGAAGGGAAAGATTTCAGCATTCATCGACTTGTCCTGGGGACA
CACACATCGGATGAACAAAACCATCTTGTTATAGCCAGTGTGCAGCTCCCTAATGATGATGCTCAGTTTG
ATGCGTCACACTACGACAGTGAGAAAGGAGAATTTGGAGGTTTTGGTTCAGTTAGTGGAAAAATTGAAAT
AGAAATCAAGATCAACCATGAAGGAGAAGTAAACAGGGCCCGTTATATGCCCCAGAACCCTTGTATCATC
GCAACAAAGACTCCTTCCAGTGATGTTCTTGTCTTTGACTATACAAAACATCCTTCTAAACCAGATCCTT
CTGGAGAGTGCAACCCAGACTTGCGTCTCCGTGGACATCAGAAGGAAGGCTATGGGCTTTCTTGGAACCC
AAATCTCAGTGGGCACTTACTTAGTGCTTCAGATGACCATACCATCTGCCTGTGGGACATCAGTGCCGTT
CCAAAGGAGGGAAAAGTGGTAGATGCGAAGACCATCTTTACAGGGCATACGGCAGTAGTAGAAGATGTTT
CCTGGCATCTACTCCATGAGTCTCTGTTTGGGTCAGTTGCTGATGATCAGAAACTTATGATTTGGGATAC
TCGTTCAAACAATACTTCCAAACCAAGCCACTCAGTTGATGCTCACACTGCTGAAGTGAACTGCCTTTCT
TTCAATCCTTATAGTGAGTTCATTCTTGCCACAGGATCAGCTGACAAGACTGTTGCCTTGTGGGATCTGA
GAAATCTGAAACTTAAGTTGCATTCCTTTGAGTCACATAAGGATGAAATATTCCAGGTTCAGTGGTCACC
TCACAATGAGACTATTTTAGCTTCCAGTGGTACTGATCGCAGACTGAATGTCTGGGATTTAAGTAAAATT
GGAGAGGAACAATCCCCAGAAGATGCAGAAGACGGGCCACCAGAGTTGTTGTTTATTCATGGTGGTCATA
CTGCCAAGATATCTGATTTCTCCTGGAATCCCAATGAACCTTGGGTGATTTGTTCTGTATCAGAAGACAA
TATCATGCAAGTGTGGCAAATGGCAGAGAACATTTATAATGATGAAGACCCTGAAGGAAGCGTGGATCCA
GAAGGACAAGGGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208761 protein sequence
Red=Cloning site Green=Tags(s)

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGT
HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCII
ATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV
PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLS
FNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKI
GEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005610
ORF Size 1275 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005610.1, NP_005601.1
RefSeq Size 7943 bp
RefSeq ORF 1278 bp
Locus ID 5928
UniProt ID Q09028
Cytogenetics 1p35.1
Domains WD40
Protein Families Druggable Genome, Transcription Factors
MW 47.7 kDa
Gene Summary This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]

Other Versions

Other products for "RBBP4"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


RBBP4 Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.