DDR2 (NM_001014796) Human Tagged ORF Clone

CAT#: RC208745

DDR2 (Myc-DDK-tagged)-Human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1

Clone Modification / Custom Cloning Service

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DDR2 (NM_001014796) Human Tagged ORF Clone
Symbol DDR2
Synonyms MIG20a; NTRKR3; TKT; TYRO10
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208745 representing NM_001014796
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCTGATTCCCAGAATGCTCTTGGTGCTGTTCCTGCTGCTGCCTATCTTGAGTTCTGCAAAAGCTC
AGGTTAATCCAGCTATATGCCGCTATCCTCTGGGCATGTCAGGAGGCCAGATTCCAGATGAGGACATCAC
AGCTTCCAGTCAGTGGTCAGAGTCCACAGCTGCCAAATATGGAAGGCTGGACTCAGAAGAAGGGGATGGA
GCCTGGTGCCCTGAGATTCCAGTGGAACCTGATGACCTGAAGGAGTTTCTGCAGATTGACTTGCACACCC
TCCATTTTATCACTCTGGTGGGGACCCAGGGGCGCCATGCAGGAGGTCATGGCATCGAGTTTGCCCCCAT
GTACAAGATCAATTACAGTCGGGATGGCACTCGCTGGATCTCTTGGCGGAACCGTCATGGGAAACAGGTG
CTGGATGGAAATAGTAACCCCTATGACATTTTCCTAAAGGACTTGGAGCCGCCCATTGTAGCCAGATTTG
TCCGGTTCATTCCAGTCACCGACCACTCCATGAATGTGTGTATGAGAGTGGAGCTTTACGGCTGTGTCTG
GCTAGATGGCTTGGTGTCTTACAATGCTCCAGCTGGGCAGCAGTTTGTACTCCCTGGAGGTTCCATCATT
TATCTGAATGATTCTGTCTATGATGGAGCTGTTGGATACAGCATGACAGAAGGGCTAGGCCAATTGACCG
ATGGTGTGTCTGGCCTGGACGATTTCACCCAGACCCATGAATACCACGTGTGGCCCGGCTATGACTATGT
GGGCTGGCGGAACGAGAGTGCCACCAATGGCTACATTGAGATCATGTTTGAATTTGACCGCATCAGGAAT
TTCACTACCATGAAGGTCCACTGCAACAACATGTTTGCTAAAGGTGTGAAGATCTTTAAGGAGGTACAGT
GCTACTTCCGCTCTGAAGCCAGTGAGTGGGAACCTAATGCCATTTCCTTCCCCCTTGTCCTGGATGACGT
CAACCCCAGTGCTCGGTTTGTCACGGTGCCTCTCCACCACCGAATGGCCAGTGCCATCAAGTGTCAATAC
CATTTTGCAGATACCTGGATGATGTTCAGTGAGATCACCTTCCAATCAGATGCTGCAATGTACAACAACT
CTGAAGCCCTGCCCACCTCTCCTATGGCACCCACAACCTATGATCCAATGCTTAAAGTTGATGACAGCAA
CACTCGGATCCTGATTGGCTGCTTGGTGGCCATCATCTTTATCCTCCTGGCCATCATTGTCATCATCCTC
TGGAGGCAGTTCTGGCAGAAAATGCTGGAGAAGGCTTCTCGGAGGATGCTGGATGATGAAATGACAGTCA
GCCTTTCCCTGCCAAGTGATTCTAGCATGTTCAACAATAACCGCTCCTCATCACCTAGTGAACAAGGGTC
CAACTCGACTTACGATCGCATCTTTCCCCTTCGCCCTGACTACCAGGAGCCATCCAGGCTGATACGAAAA
CTCCCAGAATTTGCTCCAGGGGAGGAGGAGTCAGGCTGCAGCGGTGTTGTGAAGCCAGTCCAGCCCAGTG
GCCCTGAGGGGGTGCCCCACTATGCAGAGGCTGACATAGTGAACCTCCAAGGAGTGACAGGAGGCAACAC
ATACTCAGTGCCTGCCGTCACCATGGACCTGCTCTCAGGAAAAGATGTGGCTGTGGAGGAGTTCCCCAGG
AAACTCCTAACTTTCAAAGAGAAGCTGGGAGAAGGACAGTTTGGGGAGGTTCATCTCTGTGAAGTGGAGG
GAATGGAAAAATTCAAAGACAAAGATTTTGCCCTAGATGTCAGTGCCAACCAGCCTGTCCTGGTGGCTGT
GAAAATGCTCCGAGCAGATGCCAACAAGAATGCCAGGAATGATTTTCTTAAGGAGATAAAGATCATGTCT
CGGCTCAAGGACCCAAACATCATCCATCTATTAGCTGTGTGTATCACTGATGACCCTCTCTGTATGATCA
CTGAATACATGGAGAATGGAGATCTCAATCAGTTTCTTTCCCGCCACGAGCCCCCTAATTCTTCCTCCAG
CGATGTACGCACTGTCAGTTACACCAATCTGAAGTTTATGGCTACCCAAATTGCCTCTGGCATGAAGTAC
CTTTCCTCTCTTAATTTTGTTCACCGAGATCTGGCCACACGAAACTGTTTAGTGGGTAAGAACTACACAA
TCAAGATAGCTGACTTTGGAATGAGCAGGAACCTGTACAGTGGTGACTATTACCGGATCCAGGGCCGGGC
AGTGCTCCCTATCCGCTGGATGTCTTGGGAGAGTATCTTGCTGGGCAAGTTCACTACAGCAAGTGATGTG
TGGGCCTTTGGGGTTACTTTGTGGGAGACTTTCACCTTTTGTCAAGAACAGCCCTATTCCCAGCTGTCAG
ATGAACAGGTTATTGAGAATACTGGAGAGTTCTTCCGAGACCAAGGGAGGCAGACTTACCTCCCTCAACC
AGCCATTTGTCCTGACTCTGTGTATAAGCTGATGCTCAGCTGCTGGAGAAGAGATACGAAGAACCGTCCC
TCATTCCAAGAAATCCACCTTCTGCTCCTTCAACAAGGCGACGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208745 representing NM_001014796
Red=Cloning site Green=Tags(s)

MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG
AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV
LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII
YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN
FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY
HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK
LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR
KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS
RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY
LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV
WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001014796
ORF Size 2565 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001014796.1, NP_001014796
RefSeq Size 3252
RefSeq ORF 2568
Locus ID 4921
Cytogenetics 1q23.3
Protein Families Protein Kinase, Transmembrane, Druggable Genome
MW 96.74 kDa
Gene Summary Receptor tyrosine kinases (RTKs) play a key role in the communication of cells with their microenvironment. These molecules are involved in the regulation of cell growth, differentiation, and metabolism. In several cases the biochemical mechanism by which RTKs transduce signals across the membrane has been shown to be ligand induced receptor oligomerization and subsequent intracellular phosphorylation. This autophosphorylation leads to phosphorylation of cytosolic targets as well as association with other molecules, which are involved in pleiotropic effects of signal transduction. RTKs have a tripartite structure with extracellular, transmembrane, and cytoplasmic regions. This gene encodes a member of a novel subclass of RTKs and contains a distinct extracellular region encompassing a factor VIII-like domain. Alternative splicing in the 5' UTR results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)