DDR2 (NM_001014796) Human Tagged ORF Clone

CAT#: RC208745

Reviews ()
Write a review

DDR2 (Myc-DDK-tagged)-Human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1



Reconstitution Protocol

USD 783.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "DDR2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DDR2
Synonyms MIG20a; NTRKR3; TKT; TYRO10; WRCN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208745 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCTGATTCCCAGAATGCTCTTGGTGCTGTTCCTGCTGCTGCCTATCTTGAGTTCTGCAAAAGCTC
AGGTTAATCCAGCTATATGCCGCTATCCTCTGGGCATGTCAGGAGGCCAGATTCCAGATGAGGACATCAC
AGCTTCCAGTCAGTGGTCAGAGTCCACAGCTGCCAAATATGGAAGGCTGGACTCAGAAGAAGGGGATGGA
GCCTGGTGCCCTGAGATTCCAGTGGAACCTGATGACCTGAAGGAGTTTCTGCAGATTGACTTGCACACCC
TCCATTTTATCACTCTGGTGGGGACCCAGGGGCGCCATGCAGGAGGTCATGGCATCGAGTTTGCCCCCAT
GTACAAGATCAATTACAGTCGGGATGGCACTCGCTGGATCTCTTGGCGGAACCGTCATGGGAAACAGGTG
CTGGATGGAAATAGTAACCCCTATGACATTTTCCTAAAGGACTTGGAGCCGCCCATTGTAGCCAGATTTG
TCCGGTTCATTCCAGTCACCGACCACTCCATGAATGTGTGTATGAGAGTGGAGCTTTACGGCTGTGTCTG
GCTAGATGGCTTGGTGTCTTACAATGCTCCAGCTGGGCAGCAGTTTGTACTCCCTGGAGGTTCCATCATT
TATCTGAATGATTCTGTCTATGATGGAGCTGTTGGATACAGCATGACAGAAGGGCTAGGCCAATTGACCG
ATGGTGTGTCTGGCCTGGACGATTTCACCCAGACCCATGAATACCACGTGTGGCCCGGCTATGACTATGT
GGGCTGGCGGAACGAGAGTGCCACCAATGGCTACATTGAGATCATGTTTGAATTTGACCGCATCAGGAAT
TTCACTACCATGAAGGTCCACTGCAACAACATGTTTGCTAAAGGTGTGAAGATCTTTAAGGAGGTACAGT
GCTACTTCCGCTCTGAAGCCAGTGAGTGGGAACCTAATGCCATTTCCTTCCCCCTTGTCCTGGATGACGT
CAACCCCAGTGCTCGGTTTGTCACGGTGCCTCTCCACCACCGAATGGCCAGTGCCATCAAGTGTCAATAC
CATTTTGCAGATACCTGGATGATGTTCAGTGAGATCACCTTCCAATCAGATGCTGCAATGTACAACAACT
CTGAAGCCCTGCCCACCTCTCCTATGGCACCCACAACCTATGATCCAATGCTTAAAGTTGATGACAGCAA
CACTCGGATCCTGATTGGCTGCTTGGTGGCCATCATCTTTATCCTCCTGGCCATCATTGTCATCATCCTC
TGGAGGCAGTTCTGGCAGAAAATGCTGGAGAAGGCTTCTCGGAGGATGCTGGATGATGAAATGACAGTCA
GCCTTTCCCTGCCAAGTGATTCTAGCATGTTCAACAATAACCGCTCCTCATCACCTAGTGAACAAGGGTC
CAACTCGACTTACGATCGCATCTTTCCCCTTCGCCCTGACTACCAGGAGCCATCCAGGCTGATACGAAAA
CTCCCAGAATTTGCTCCAGGGGAGGAGGAGTCAGGCTGCAGCGGTGTTGTGAAGCCAGTCCAGCCCAGTG
GCCCTGAGGGGGTGCCCCACTATGCAGAGGCTGACATAGTGAACCTCCAAGGAGTGACAGGAGGCAACAC
ATACTCAGTGCCTGCCGTCACCATGGACCTGCTCTCAGGAAAAGATGTGGCTGTGGAGGAGTTCCCCAGG
AAACTCCTAACTTTCAAAGAGAAGCTGGGAGAAGGACAGTTTGGGGAGGTTCATCTCTGTGAAGTGGAGG
GAATGGAAAAATTCAAAGACAAAGATTTTGCCCTAGATGTCAGTGCCAACCAGCCTGTCCTGGTGGCTGT
GAAAATGCTCCGAGCAGATGCCAACAAGAATGCCAGGAATGATTTTCTTAAGGAGATAAAGATCATGTCT
CGGCTCAAGGACCCAAACATCATCCATCTATTAGCTGTGTGTATCACTGATGACCCTCTCTGTATGATCA
CTGAATACATGGAGAATGGAGATCTCAATCAGTTTCTTTCCCGCCACGAGCCCCCTAATTCTTCCTCCAG
CGATGTACGCACTGTCAGTTACACCAATCTGAAGTTTATGGCTACCCAAATTGCCTCTGGCATGAAGTAC
CTTTCCTCTCTTAATTTTGTTCACCGAGATCTGGCCACACGAAACTGTTTAGTGGGTAAGAACTACACAA
TCAAGATAGCTGACTTTGGAATGAGCAGGAACCTGTACAGTGGTGACTATTACCGGATCCAGGGCCGGGC
AGTGCTCCCTATCCGCTGGATGTCTTGGGAGAGTATCTTGCTGGGCAAGTTCACTACAGCAAGTGATGTG
TGGGCCTTTGGGGTTACTTTGTGGGAGACTTTCACCTTTTGTCAAGAACAGCCCTATTCCCAGCTGTCAG
ATGAACAGGTTATTGAGAATACTGGAGAGTTCTTCCGAGACCAAGGGAGGCAGACTTACCTCCCTCAACC
AGCCATTTGTCCTGACTCTGTGTATAAGCTGATGCTCAGCTGCTGGAGAAGAGATACGAAGAACCGTCCC
TCATTCCAAGAAATCCACCTTCTGCTCCTTCAACAAGGCGACGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208745 protein sequence
Red=Cloning site Green=Tags(s)

MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG
AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV
LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII
YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN
FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY
HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK
LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR
KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS
RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY
LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV
WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001014796
ORF Size 2565 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001014796.3
RefSeq Size 3252 bp
RefSeq ORF 2568 bp
Locus ID 4921
UniProt ID Q16832
Cytogenetics 1q23.3
Protein Families Druggable Genome, Protein Kinase, Transmembrane
MW 96.7 kDa
Gene Summary This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia. [provided by RefSeq, Aug 2017]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.