CTNNA2 (NM_004389) Human Tagged ORF Clone

CAT#: RC208731

CTNNA2 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 2 (CTNNA2), transcript variant 1

Change vector?

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CTNNA2 (NM_004389) Human Tagged ORF Clone
Symbol CTNNA2
Synonyms CAP-R; CAPR; CT114; CTNR
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208731 representing NM_004389
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTCGGCAACTTCACCTATCATTCTGAAATGGGACCCCAAAAGTTTGGAAATCCGGACGCTAACAG
TGGAAAGGCTGTTGGAGCCACTTGTTACACAGGTGACTACACTTGTCAACACAAGCAACAAAGGCCCATC
TGGTAAAAAGAAAGGGAGGTCAAAGAAAGCCCATGTACTAGCTGCCTCTGTAGAGCAAGCCACTCAGAAT
TTCCTGGAAAAGGGTGAACAGATCGCTAAGGAGAGTCAAGATCTCAAAGAAGAGTTGGTGGCTGCTGTAG
AGGATGTGCGCAAACAAGGTGAGACGATGCGGATCGCCTCCTCCGAGTTTGCAGATGACCCTTGCTCGTC
GGTAAAGCGCGGCACCATGGTACGGGCGGCAAGGGCTTTGCTCTCCGCGGTGACACGCTTACTCATCCTG
GCGGACATGGCAGATGTCATGAGACTTTTATCCCATCTGAAAATTGTGGAAGAGGCCCTGGAAGCTGTCA
AAAATGCTACAAATGAGCAAGACCTTGCAAACCGTTTTAAAGAGTTTGGGAAAGAGATGGTGAAACTTAA
CTATGTAGCAGCAAGAAGACAACAGGAGCTGAAGGATCCTCACTGTCGGGATGAGATGGCAGCCGCCCGA
GGGGCTCTGAAGAAGAATGCCACAATGCTGTACACGGCCTCTCAAGCATTTCTCCGCCACCCAGATGTCG
CCGCTACGAGAGCCAACCGAGATTATGTGTTCAAACAAGTCCAGGAGGCCATCGCCGGCATCTCCAATGC
TGCTCAAGCTACCTCGCCCACTGACGAAGCCAAGGGCCACACGGGCATCGGCGAGCTGGCTGCGGCTCTT
AATGAGTTTGACAATAAGATTATCCTGGACCCCATGACGTTCAGCGAGGCCAGGTTCCGGCCGTCCCTGG
AGGAGAGGCTGGAGAGCATCATCAGCGGCGCAGCGCTGATGGCCGACTCCTCCTGCACGCGAGACGACCG
GCGCGAGAGGATCGTGGCGGAGTGCAACGCCGTGCGGCAGGCGCTCCAGGACCTGCTCAGCGAGTACATG
AATAATACTGGAAGGAAAGAAAAAGGAGATCCTCTCAACATTGCGATTGATAAGATGACTAAGAAAACAA
GAGATCTAAGGAGACAGCTTCGGAAAGCAGTGATGGATCACATATCTGACTCTTTCCTGGAAACCAATGT
TCCTTTGCTAGTTCTCATTGAGGCTGCAAAGAGCGGAAATGAAAAGGAAGTGAAAGAATATGCCCAAGTT
TTCCGTGAGCATGCCAACAAACTGGTAGAGGTTGCCAATTTGGCCTGTTCCATCTCCAACAATGAAGAAG
GGGTGAAATTAGTTCGGATGGCAGCCACCCAGATTGACAGCCTGTGTCCCCAGGTCATCAATGCCGCTCT
GACACTGGCTGCCCGGCCACAGAGCAAAGTTGCTCAGGATAACATGGACGTCTTCAAAGACCAGTGGGAG
AAGCAGGTCCGAGTGTTGACAGAGGCCGTGGATGACATCACCTCAGTGGATGACTTCCTCTCTGTCTCAG
AAAATCACATCTTGGAGGATGTGAACAAGTGTGTGATAGCCCTCCAAGAGGGCGATGTGGACACTCTGGA
CCGGACTGCAGGGGCCATCAGGGGCCGGGCAGCTCGAGTCATACACATCATCAATGCTGAGATGGAGAAC
TATGAAGCTGGGGTTTATACTGAGAAGGTGTTGGAAGCTACAAAATTGCTTTCTGAAACAGTGATGCCAC
GCTTCGCTGAACAAGTAGAGGTTGCCATTGAAGCCCTGAGTGCCAACGTTCCTCAACCGTTTGAGGAGAA
TGAGTTCATCGATGCCTCTCGCCTGGTGTATGATGGCGTTCGGGACATCAGAAAGGCTGTGCTGATGATC
AGGACCCCAGAAGAACTAGAGGATGATTCTGACTTTGAGCAAGAAGATTATGATGTGCGTAGCAGGACAA
GTGTTCAGACTGAGGATGACCAGCTCATTGCAGGGCAGAGCGCACGGGCCATCATGGCGCAACTACCGCA
GGAGGAGAAGGCAAAAATAGCTGAGCAGGTGGAGATATTCCATCAAGAGAAAAGCAAGCTGGATGCAGAA
GTGGCCAAATGGGACGACAGCGGCAATGATATCATTGTACTGGCCAAGCAGATGTGTATGATCATGATGG
AAATGACAGACTTCACAAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAA
AATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCA
TGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCA
AGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCT
TATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACC
AAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAG
AGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAA
GAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208731 representing NM_004389
Red=Cloning site Green=Tags(s)

MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQN
FLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLIL
ADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAAR
GALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAAL
NEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYM
NNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWE
KQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMEN
YEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMI
RTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAE
VAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSA
CKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVAST
KYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004389
ORF Size 2715 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004389.2, NM_004389.3, NP_004380
RefSeq Size 3853
RefSeq ORF 2718
Locus ID 1496
Cytogenetics 2p12
Domains Vinculin
Protein Families Druggable Genome
Protein Pathways Adherens junction, Tight junction, Leukocyte transendothelial migration, Pathways in cancer, Endometrial cancer, Arrhythmogenic right ventricular cardiomyopathy (ARVC)
MW 100.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations