ARHGEF11 (NM_198236) Human Tagged ORF Clone

CAT#: RC208729

ARHGEF11 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 11 (ARHGEF11), transcript variant 2

Clone Modification / Custom Cloning Service

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARHGEF11 (NM_198236) Human Tagged ORF Clone
Symbol ARHGEF11
Synonyms GTRAP48; PDZ-RHOGEF
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208729 representing NM_198236
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGTAAGGTTACCCCAGAGTATAGACAGGTTAAGTAGCCTGTCTTCTCTGGGAGATTCTGCACCAG
AGCGCAAGTCCCCTTCCCACCATCGCCAGCCTTCGGATGCCTCTGAGACAACAGGTCTCGTTCAACGCTG
TGTCATTATCCAAAAGGACCAGCATGGCTTCGGCTTCACAGTCAGTGGGGATCGCATTGTTCTGGTGCAG
TCTGTGCGGCCTGGAGGTGCAGCCATGAAGGCCGGTGTGAAAGAGGGCGACCGGATCATCAAAGTCAACG
GCACCATGGTGACCAATAGCTCACACCTGGAAGTGGTAAAGCTGATCAAATCTGGCGCCTATGTCGCACT
CACCCTCCTGGGCTCTTCACCTTCATCCATGGGCATCTCTGGGCTCCAGCAGGACCCATCCCCAGCAGGA
GCTCCCCGAATCACGTCAGTGATCCCCTCACCACCACCTCCTCCACCTCTACCACCTCCACAACGCATCA
CAGGACCCAAACCTCTGCAGGATCCCGAAGTTCAAAAACATGCCACCCAGATCCTCAGGAATATGCTGAG
GCAGGAAGAAAAAGAATTACAGCGTATCTGTGAGGTCTATAGCCGGAACCCCGCCAGCCTACTGGAAGAG
CAGATCGAAGGTGCCCGGCGGCGAGTCACTCAGTTACAGCTGAAGATCCAGCAGGAGACTGGTGGCTCAG
TGGACATACTTCCACTATATGGTGACACCAGCCAGAGACCATCAGAAGGCCGGCTCTCTCTGGATTCCCA
GGAGGGGGACAGTGGCTTGGACTCTGGGACAGAACGCTTTCCTTCCCTCAGTGAGTCATTGATGAATCGG
AACTCGGTACTGTCAGACCCTGGGCTAGACAGTCCTCGAACCTCCCCTGTGATCATGGCCAGGGTGGCCC
AGCACCACAGGCGGCAGGGCTCGGATGCAGCAGTCCCCTCAACCGGTGACCAGGGTGTAGATCAAAGCCC
AAAGCCTTTAATTATTGGCCCAGAGGAAGACTATGACCCGGGTTATTTCAACAACGAGAGCGACATCATA
TTCCAGGATCTGGAGAAACTGAAGTCTCGGCCAGCTCACCTGGGGGTTTTTCTACGTTACATCTTCTCTC
AGGCGGACCCCAGTCCACTGCTTTTTTACCTGTGTGCAGAAGTTTATCAGCAGGCAAGCCCCAAGGATTC
CCGAAGCTTGGGGAAAGACATCTGGAATATTTTCCTGGAGAAAAATGCGCCTCTGAGAGTGAAGATCCCT
GAGATGCTACAGGCTGAAATTGACTCGCGCCTGCGGAACAGCGAAGATGCCCGTGGTGTTCTCTGTGAAG
CTCAAGAGGCAGCCATGCCTGAGATCCAAGAGCAGATCCACGACTACAGAACGAAGCGCACACTGGGGCT
GGGCAGCCTGTATGGTGAAAATGACCTGCTGGACCTGGATGGGGACCCTCTCCGAGAGCGCCAAGTGGCT
GAGAAGCAGCTGGCTGCCCTTGGAGATATTTTGTCCAAGTATGAGGAAGACAGGAGCGCCCCCATGGACT
TCGCCCTCAATACCTACATGAGCCATGCTGGGATCCGTCTTCGAGAGGCACGACCTTCCAACACAGCTGA
AAAGGCCCAGTCTGCTCCTGACAAGGACAAGTGGCTACCGTTCTTCCCTAAGACCAAGAAGAGCAGCAAT
TCCAAGAAAGAAAAGGATGCCTTGGAGGACAAGAAGCGAAACCCTATCCTCAAATACATTGGGAAGCCCA
AAAGCTCTTCTCAAAGCACATTTCATATTCCCTTGTCCCCTGTGGAAGTCAAACCAGGCAATGTGAGGAA
CATCATTCAGCACTTTGAGAACAACCAGCAGTATGATGCCCCAGAACCTGGGACACAACGACTCTCGACC
GGAAGCTTTCCTGAGGACCTGCTGGAGAGTGACAGTTCACGCTCAGAGATTCGCCTGGGCCGCTCTGAAA
GCCTCAAGGGCCGGGAAGAGATGAAACGGTCTCGAAAGGCAGAGAACGTGCCCCGCTCTCGCAGTGATGT
TGACATGGATGCTGCTGCGGAGGCTACTCGCCTGCACCAGTCAGCCTCGTCCTCTACCTCCAGCCTCTCC
ACCAGGTCTCTTGAGAACCCAACCCCTCCATTCACTCCCAAAATGGGCCGCAGGAGCATTGAGTCCCCCA
GTTTGGGGTTCTGCACAGATACCCTCCTTCCCCACCTCCTAGAGGATGATCTGGGCCAGCTGTCTGACCT
GGAGCCAGAGCCAGATGCCCAAAATTGGCAGCATACAGTGGGCAAGGATGTGGTGGCTGGGCTAACCCAG
CGGGAGATTGACCGGCAAGAGGTCATCAATGAGCTGTTTGTGACTGAAGCTTCCCACCTGCGCACACTCC
GGGTCCTGGACCTGATCTTCTACCAGCGAATGAAGAAGGAGAACCTGATGCCCCGGGAGGAGCTGGCCCG
GCTCTTCCCGAACCTGCCTGAACTCATAGAGATTCACAATTCCTGGTGTGAAGCCATGAAGAAGCTCCGG
GAGGAAGGCCCCATCATCAAAGAGATCAGTGACCTCATGCTGGCCCGGTTTGATGGCCCTGCCCGAGAGG
AACTCCAGCAAGTGGCTGCACAGTTCTGTTCCTATCAGTCAATAGCCCTAGAGCTAATCAAGACCAAGCA
ACGCAAGGAGAGTCGATTCCAGCTCTTCATGCAGGAGGCTGAGAGCCACCCTCAGTGTCGGCGGCTGCAG
CTGAGAGACCTCATCATCTCTGAGATGCAGCGGCTCACCAAGTACCCGCTGCTGCTGGAGAGCATCATCA
AGCACACAGAGGGTGGCACCTCTGAGCATGAGAAGCTGTGCCGGGCCCGGGACCAGTGCCGGGAGATTCT
CAAGTATGTGAATGAAGCGGTAAAACAAACAGAGAACCGCCACCGTTTAGAGGGCTACCAGAAACGCCTG
GATGCCACCGCCCTGGAGAGGGCCAGCAACCCCCTGGCAGCAGAGTTCAAGAGCCTGGATCTTACAACCA
GAAAAATGATCCATGAGGGACCCCTGACCTGGAGGATCAGCAAGGATAAGACCTTGGACCTCCACGTGCT
GCTGCTGGAGGACCTCCTAGTGCTGCTACAGAAACAGGATGAGAAGCTATTGCTGAAGTGCCACAGCAAG
ACTGCTGTGGGCTCCTCAGACAGCAAGCAGACCTTCAGCCCCGTGCTCAAGCTCAATGCTGTGCTCATCC
GCTCTGTGGCCACAGATAAACGGGCCTTCTTCATCATCTGCACCTCCAAGCTGGGCCCACCCCAGATCTA
TGAGCTGGTTGCATTGACGTCATCAGACAAGAACACATGGATGGAGCTCTTAGAAGAGGCCGTGCGGAAT
GCCACCAGGCACCCCGGAGCTGCCCCAATGCCCGTCCATCCTCCACCCCCAGGTCCCCGGGAGCCAGCCC
AGCAGGGCCCCACACCCAGCAGGGTAGAACTGGATGACTCAGACGTGTTCCATGGTGAACCTGAACCTGA
GGAGCTGCCTGGAGGCACTGGGTCCCAGCAGAGGGTCCAAGGGAAGCACCAGGTCCTGCTAGAGGACCCT
GAGCAGGAGGGCAGTGCAGAGGAAGAGGAACTGGGTGTCCTGCCTTGCCCTTCCACATCCCTGGATGGAG
AGAACAGGGGCATCAGGACAAGGAACCCCATCCACTTGGCCTTCCCAGGCCCTCTGTTCATGGAAGGGCT
CGCTGACTCCGCTCTGGAAGATGTGGAGAACCTGCGACATCTGATCCTGTGGAGCCTGCTGCCAGGTCAC
ACCATGGAAACTCAGGCTGCCCAGGAGCCCGAGGACGACCTGACACCCACACCTTCTGTCATCAGCGTCA
CCTCTCACCCCTGGGACCCAGGCTCCCCAGGGCAAGCACCCCCTGGGGGTGAAGGGGACAACACCCAGCT
TGCAGGGCTGGAGGGGGAACGGCCAGAGCAGGAAGACATGGGTCTCTGTTCTCTGGAACACCTACCCCCA
AGGACCAGAAATTCTGGGATATGGGAGTCTCCAGAACTGGACAGGAATCTGGCTGAAGATGCTTCAAGCA
CAGAGGCAGCAGGAGGTTACAAAGTTGTGAGAAAAGCTGAGGTGGCAGGCAGCAAGGTTGTCCCTGCACT
ACCAGAGAGTGGCCAGTCAGAGCCTGGGCCACCTGAAGTGGAAGGCGGAACAAAGGCTACGGGGAACTGC
TTTTATGTCAGCATGCCATCAGGACCCCCGGACTCAAGCACCGACCACTCAGAGGCACCCATGAGCCCCC
CTCAGCCTGACAGCCTCCCTGCAGGGCAGACAGAGCCTCAGCCTCAGCTGCAGGGAGGCAACGATGATCC
AAGACGCCCCAGCCGCTCTCCTCCAAGCCTGGCCCTCAGGGACGTGGGCATGATCTTCCATACCATTGAG
CAGCTCACTCTCAAGCTCAACAGGCTCAAGGATATGGAGCTGGCCCACAGAGAGCTGCTCAAGTCCCTTG
GGGGAGAGTCATCTGGTGGCACCACGCCTGTGGGCAGTTTCCACACAGAAGCAGCTAGATGGACAGATGG
CTCCCTCTCACCTCCCGCTAAGGAGCCCCTAGCTTCTGACTCCAGGAACAGCCATGAACTGGGGCCCTGC
CCTGAGGATGGCTCTGACGCCCCCCTGGAAGACAGCACAGCAGACGCAGCCGCGTCACCAGGACCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208729 representing NM_198236
Red=Cloning site Green=Tags(s)

MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFTVSGDRIVLVQ
SVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSPSSMGISGLQQDPSPAG
APRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQILRNMLRQEEKELQRICEVYSRNPASLLEE
QIEGARRRVTQLQLKIQQETGGSVDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNR
NSVLSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDPGYFNNESDII
FQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVA
EKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSN
SKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLST
GSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLS
TRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQ
REIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLR
EEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQ
LRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRL
DATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSK
TAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRN
ATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQGKHQVLLEDP
EQEGSAEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADSALEDVENLRHLILWSLLPGH
TMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGGEGDNTQLAGLEGERPEQEDMGLCSLEHLPP
RTRNSGIWESPELDRNLAEDASSTEAAGGYKVVRKAEVAGSKVVPALPESGQSEPGPPEVEGGTKATGNC
FYVSMPSGPPDSSTDHSEAPMSPPQPDSLPAGQTEPQPQLQGGNDDPRRPSRSPPSLALRDVGMIFHTIE
QLTLKLNRLKDMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPC
PEDGSDAPLEDSTADAAASPGP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_198236
ORF Size 4686 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_198236.1, NM_198236.2, NP_937879
RefSeq Size 6904
RefSeq ORF 4689
Locus ID 9826
Cytogenetics 1q23.1
Protein Families Druggable Genome
Protein Pathways Vascular smooth muscle contraction
MW 172.1 kDa
Gene Summary Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A similar protein in rat interacts with glutamate transporter EAAT4 and modulates its glutamate transport activity. Expression of the rat protein induces the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations